254781054

254781054

ribose-5-phosphate isomerase A

GeneID in NCBI database:8210077Locus tag:CLIBASIA_04780
Protein GI in NCBI database:254781054Protein Accession:YP_003065467.1
Gene range:+(1058745, 1059440)Protein Length:231aa
Gene description:ribose-5-phosphate isomerase A
COG prediction:[G] Ribose 5-phosphate isomerase
KEGG prediction:rpiA; ribose-5-phosphate isomerase A (EC:5.3.1.6); K01807 ribose 5-phosphate isomerase A [EC:5.3.1.6]
SEED prediction:Ribose 5-phosphate isomerase A (EC 5.3.1.6)
Pathway involved in KEGG:Pentose phosphate pathway [PATH:las00030]
Subsystem involved in SEED:Pentose phosphate pathway;
Glycolate, glyoxylate interconversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
ccHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEHHHcccccEEEEccccccccccEEEccHHHHHHHHHHHHHccEEEEEEEcccEEcccccccccEEEEEccHHHHHHHHHHHHHHcccccccEEEEcccccEEEEcccEEEEEEccccccHHHHHHHHHccccEEEccEEcccccEEEEEcccccEEEEEc
ccHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEccHHHcccEEEEEEcccEEcccccEEccccccHHHHHHHHccEEEEEEEEEHHHEccccccccccEEEEcHHHHHHHHHHHHHHHHHccEEEEcEccccccEcccccccEEEEEEccccccHHHHHHHHHccccEEEEcEEcccccEEEEEEccEcEEEEEc
MDALQMKRNAARRAIQYVVDgmtlgmgtgsTAKEFMILLADKIANGfrvqvipssrntenfckihhiplhspedvssvdlsidgfdEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGdeskrvdflgrgmlpieidqFGVNKTLSALKEVASCfglneelrlrrngsglfvsdggnyivdaffgfipdpqiisgelcnipgviehglfINMVDCaiigtsdgeclvlqk
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIplhspedvssVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
****QMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGE***L**
*********AARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK
MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
315122392242 ribose-5-phosphate isomerase A [Candidatus Liberibacter 1 1e-102
218462659232 ribose-5-phosphate isomerase A [Rhizobium etli Kim 5] L 1 2e-62
190892059232 ribose 5-phosphate isomerase [Rhizobium etli CIAT 652] 1 4e-62
241204952232 ribose-5-phosphate isomerase A [Rhizobium leguminosarum 1 1e-61
218682852232 ribose-5-phosphate isomerase A [Rhizobium etli CIAT 894 1 1e-61
327190617466 ribose 5-phosphate isomerase protein [Rhizobium etli CN 1 2e-61
116252445232 ribose-5-phosphate isomerase A [Rhizobium leguminosarum 1 5e-61
86357995232 ribose-5-phosphate isomerase A [Rhizobium etli CFN 42] 1 2e-60
227822248231 ribose-5-phosphate isomerase A [Sinorhizobium fredii NG 1 2e-60
209549606232 ribose-5-phosphate isomerase A [Rhizobium leguminosarum 1 1e-59
>gi|315122392|ref|YP_004062881.1| ribose-5-phosphate isomerase A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 242 Back     alignment and organism information
 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 209/231 (90%)

Query: 1   MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60
           +DALQMK+N AR AIQ+V DGMTLGMGTGST+KEFMILLA+KIANG  VQV+PSSR+TEN
Sbjct: 12  IDALQMKKNVARLAIQHVDDGMTLGMGTGSTSKEFMILLAEKIANGLHVQVVPSSRDTEN 71

Query: 61  FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120
           FCK + I L S EDVSS+DLS+DGFDEIDSRLRLIKGYGGA+LREKIIA+A+SR IVIGD
Sbjct: 72  FCKKNGILLRSIEDVSSIDLSVDGFDEIDSRLRLIKGYGGAILREKIIANASSRVIVIGD 131

Query: 121 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI 180
           ESKRVDFLGRGMLPIE+D FG+  T+SAL E+ASC GL E+ RLRRNGS LFVSDGG++I
Sbjct: 132 ESKRVDFLGRGMLPIEVDPFGMRATISALAELASCLGLKEDFRLRRNGSELFVSDGGHHI 191

Query: 181 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK 231
           VDAFFGFIPDPQ++S EL NIPGV+EHGLFI+MVDCAIIG S+GECLVL+K
Sbjct: 192 VDAFFGFIPDPQLLSEELSNIPGVMEHGLFIDMVDCAIIGMSNGECLVLEK 242


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218462659|ref|ZP_03502750.1| ribose-5-phosphate isomerase A [Rhizobium etli Kim 5] Length = 232 Back     alignment and organism information
>gi|190892059|ref|YP_001978601.1| ribose 5-phosphate isomerase [Rhizobium etli CIAT 652] Length = 232 Back     alignment and organism information
>gi|241204952|ref|YP_002976048.1| ribose-5-phosphate isomerase A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 232 Back     alignment and organism information
>gi|218682852|ref|ZP_03530453.1| ribose-5-phosphate isomerase A [Rhizobium etli CIAT 894] Length = 232 Back     alignment and organism information
>gi|327190617|gb|EGE57705.1| ribose 5-phosphate isomerase protein [Rhizobium etli CNPAF512] Length = 466 Back     alignment and organism information
>gi|116252445|ref|YP_768283.1| ribose-5-phosphate isomerase A [Rhizobium leguminosarum bv. viciae 3841] Length = 232 Back     alignment and organism information
>gi|86357995|ref|YP_469887.1| ribose-5-phosphate isomerase A [Rhizobium etli CFN 42] Length = 232 Back     alignment and organism information
>gi|227822248|ref|YP_002826219.1| ribose-5-phosphate isomerase A [Sinorhizobium fredii NGR234] Length = 231 Back     alignment and organism information
>gi|209549606|ref|YP_002281523.1| ribose-5-phosphate isomerase A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 232 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
PRK00702220 PRK00702, PRK00702, ribose-5-phosphate isomerase A; Pro 1e-70
cd01398213 cd01398, RPI_A, RPI_A: Ribose 5-phosphate isomerase typ 2e-63
TIGR00021218 TIGR00021, rpiA, ribose 5-phosphate isomerase 7e-63
PLN02384264 PLN02384, PLN02384, ribose-5-phosphate isomerase 3e-40
KOG3075261 KOG3075, KOG3075, KOG3075, Ribose 5-phosphate isomerase 8e-38
PRK13978228 PRK13978, PRK13978, ribose-5-phosphate isomerase A; Pro 4e-35
COG0120227 COG0120, RpiA, Ribose 5-phosphate isomerase [Carbohydra 4e-66
pfam06026172 pfam06026, Rib_5-P_isom_A, Ribose 5-phosphate isomerase 6e-55
pfam00455157 pfam00455, DeoR, Bacterial regulatory proteins, deoR fa 7e-04
>gnl|CDD|179091 PRK00702, PRK00702, ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>gnl|CDD|73164 cd01398, RPI_A, RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway Back     alignment and domain information
>gnl|CDD|161668 TIGR00021, rpiA, ribose 5-phosphate isomerase Back     alignment and domain information
>gnl|CDD|178010 PLN02384, PLN02384, ribose-5-phosphate isomerase Back     alignment and domain information
>gnl|CDD|38285 KOG3075, KOG3075, KOG3075, Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184433 PRK13978, PRK13978, ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>gnl|CDD|30469 COG0120, RpiA, Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|147924 pfam06026, Rib_5-P_isom_A, Ribose 5-phosphate isomerase A (phosphoriboisomerase A) Back     alignment and domain information
>gnl|CDD|109510 pfam00455, DeoR, Bacterial regulatory proteins, deoR family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
TIGR00021236 rpiA ribose 5-phosphate isomerase A; InterPro: IPR00478 100.0
PRK00702222 ribose-5-phosphate isomerase A; Provisional 100.0
PRK13978228 ribose-5-phosphate isomerase A; Provisional 100.0
COG0120227 RpiA Ribose 5-phosphate isomerase [Carbohydrate transpo 100.0
cd01398213 RPI_A RPI_A: Ribose 5-phosphate isomerase type A (RPI_A 100.0
KOG3075261 consensus 100.0
pfam06026172 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphor 100.0
pfam00455157 DeoR Bacterial regulatory proteins, deoR family. 99.08
PRK10906252 DNA-binding transcriptional repressor GlpR; Provisional 99.01
PRK10411240 DNA-binding transcriptional activator FucR; Provisional 99.0
PRK09802269 DNA-binding transcriptional regulator AgaR; Provisional 98.98
PRK10434256 srlR DNA-bindng transcriptional repressor SrlR; Provisi 98.95
PRK13509251 transcriptional repressor UlaR; Provisional 98.87
PRK10681252 DNA-binding transcriptional repressor DeoR; Provisional 98.87
COG1349253 GlpR Transcriptional regulators of sugar metabolism [Tr 98.69
COG1184301 GCD2 Translation initiation factor 2B subunit, eIF-2B a 97.45
COG2057225 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, beta 97.39
pfam01008281 IF-2B Initiation factor 2 subunit family. This family i 97.21
PRK08535316 translation initiation factor IF-2B subunit delta; Prov 97.13
PRK08335276 translation initiation factor IF-2B subunit alpha; Vali 96.58
KOG1466313 consensus 96.35
TIGR02428208 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit; Int 94.62
TIGR03458 485 YgfH_subfam succinate CoA transferases. A closely relat 94.41
pfam02550198 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-term 93.99
TIGR00511303 aIF-2BII_fam translation initiation factor, putative, a 93.07
PRK06372253 translation initiation factor IF-2B subunit delta; Prov 92.88
COG0427 501 ACH1 Acetyl-CoA hydrolase [Energy production and conver 92.43
pfam04198255 Sugar-bind Putative sugar-binding domain. This probable 95.87
COG2390321 DeoR Transcriptional regulator, contains sigma factor-r 95.26
cd00458169 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isom 91.14
>TIGR00021 rpiA ribose 5-phosphate isomerase A; InterPro: IPR004788 Ribose 5-phosphate isomerase (5 Back     alignment and domain information
>PRK00702 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>PRK13978 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>COG0120 RpiA Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01398 RPI_A RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway Back     alignment and domain information
>KOG3075 consensus Back     alignment and domain information
>pfam06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A) Back     alignment and domain information
>pfam00455 DeoR Bacterial regulatory proteins, deoR family Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2057 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit [Lipid metabolism] Back     alignment and domain information
>pfam01008 IF-2B Initiation factor 2 subunit family Back     alignment and domain information
>PRK08535 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>PRK08335 translation initiation factor IF-2B subunit alpha; Validated Back     alignment and domain information
>KOG1466 consensus Back     alignment and domain information
>TIGR02428 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit; InterPro: IPR012791 CoA-transferases catalyse the reversible transfer of of coenzyme A from CoA-thioesters to free acids, and can be divided into three families Back     alignment and domain information
>TIGR03458 YgfH_subfam succinate CoA transferases Back     alignment and domain information
>pfam02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain Back     alignment and domain information
>TIGR00511 aIF-2BII_fam translation initiation factor, putative, aIF-2BII family; InterPro: IPR005250 The delineation of this family is based in part on a discussion and neighbour-joining phylogenetic study , , of archaeal and other proteins homologous to the alpha, beta, and delta subunits of eukaryotic initiation factor 2B (eIF-2B), a five-subunit molecule that catalyzes GTP recycling for eIF-2 Back     alignment and domain information
>PRK06372 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>COG0427 ACH1 Acetyl-CoA hydrolase [Energy production and conversion] Back     alignment and domain information
>pfam04198 Sugar-bind Putative sugar-binding domain Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>cd00458 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isomerase family; includes type A ribose 5-phosphate isomerase (RPI_A), glucosamine-6-phosphate (GlcN6P) deaminase, and 6-phosphogluconolactonase (6PGL) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
3hhe_A255 Crystal Structure Of Ribose-5-Phosphate Isomerase A 3e-67
1lk5_A229 Structure Of The D-Ribose-5-Phosphate Isomerase Fro 5e-63
1ks2_A219 Crystal Structure Analysis Of The Rpia, Structural 2e-60
1lkz_A219 Crystal Structure Of D-Ribose-5-Phosphate Isomerase 3e-59
3enq_A235 Substrate And Inhibitor Complexes Of Ribose 5-Phosp 2e-57
1uj5_A227 Crystal Structure Of Thermus Thermophilus Ribose-5- 7e-56
2pjm_B226 Structure Of Ribose 5-Phosphate Isomerase A From Me 5e-55
3l7o_A225 Crystal Structure Of Ribose-5-Phosphate Isomerase A 1e-54
1m0s_A219 Northeast Structural Genomics Consortium (Nesg Id I 1e-54
1uj4_A227 Crystal Structure Of Thermus Thermophilus Ribose-5- 7e-54
3kwm_A224 Crystal Structure Of Ribose-5-Isomerase A Length = 4e-51
1xtz_A264 Crystal Structure Of The S. Cerevisiae D-Ribose-5-P 2e-49
2f8m_A244 Ribose 5-Phosphate Isomerase From Plasmodium Falcip 5e-47
>gi|238538032|pdb|3HHE|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase A From Bartonella Henselae Length = 255 Back     alignment and structure
 Score =  258 bits (660), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 102/230 (44%), Positives = 151/230 (65%)

Query: 1   MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTEN 60
           M+  Q+K+ AA +A+++V D M LG+G+GST  EF+ LL +++ANG RV  + +S+ +E 
Sbjct: 22  MNVQQLKKMAALKALEFVEDDMRLGIGSGSTVNEFIPLLGERVANGLRVTCVATSQYSEQ 81

Query: 61  FCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGD 120
            C    +P+ + E +  +DL IDG DEI   + LIKG GGALL EKI+A A+    VI D
Sbjct: 82  LCHKFGVPISTLEKIPELDLDIDGADEIGPEMTLIKGGGGALLHEKIVASASRAMFVIAD 141

Query: 121 ESKRVDFLGRGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGGNYI 180
           E+K V  LG   LPIE++ FG++ T  A+++ A   GL+ E+ LR NG   F +DGG++I
Sbjct: 142 ETKMVKTLGAFALPIEVNPFGIHATRIAIEKAADNLGLSGEITLRMNGDDPFKTDGGHFI 201

Query: 181 VDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQ 230
            DAF+G I  P+++S  L  IPGV+EHGLF+ +   AI+  +D +  VL+
Sbjct: 202 FDAFWGRILQPKLLSEALLAIPGVVEHGLFLGLASRAIVAMADSQIKVLE 251


gi|21730740|pdb|1LK5|A Chain A, Structure Of The D-Ribose-5-Phosphate Isomerase From Pyrococcus Horikoshii Length = 229 Back     alignment and structure
>gi|23200281|pdb|1KS2|A Chain A, Crystal Structure Analysis Of The Rpia, Structural Genomics, Protein Ec1268. Length = 219 Back     alignment and structure
>gi|21466109|pdb|1LKZ|A Chain A, Crystal Structure Of D-Ribose-5-Phosphate Isomerase (Rpia) From Escherichia Coli. Length = 219 Back     alignment and structure
>gi|260099879|pdb|3ENQ|A Chain A, Substrate And Inhibitor Complexes Of Ribose 5-Phosphate Isomerase A From Vibrio Vulnificus Yj016 Length = 235 Back     alignment and structure
gi|51247842|pdb|1UJ5|A Chain A, Crystal Structure Of Thermus Thermophilus Ribose-5- Phosphate Isomerase Complexed With Ribose-5-Phosphate Length = 227 Back     alignment and structure
gi|316983217|pdb|3L7O|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase A From Streptococcus Mutans Ua159 Length = 225 Back     alignment and structure
>gi|23200407|pdb|1M0S|A Chain A, Northeast Structural Genomics Consortium (Nesg Id Ir21) Length = 219 Back     alignment and structure
>gi|51247841|pdb|1UJ4|A Chain A, Crystal Structure Of Thermus Thermophilus Ribose-5- Phosphate Isomerase Length = 227 Back     alignment and structure
gi|283135401|pdb|3KWM|A Chain A, Crystal Structure Of Ribose-5-Isomerase A Length = 224 Back     alignment and structure
>gi|75765507|pdb|1XTZ|A Chain A, Crystal Structure Of The S. Cerevisiae D-Ribose-5-Phosphate Isomerase: Comparison With The Archeal And Bacterial Enzymes Length = 264 Back     alignment and structure
>gi|85544643|pdb|2F8M|A Chain A, Ribose 5-Phosphate Isomerase From Plasmodium Falciparum Length = 244 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
1lk5_A229 D-ribose-5-phosphate isomerase; alpha/beta structure; 1 3e-57
1o8b_A219 Ribose 5-phosphate isomerase; RPIA, PSI, protein struct 2e-54
3kwm_A224 Ribose-5-phosphate isomerase A; structural genomics, ID 3e-54
3hhe_A255 Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, 4e-53
1m0s_A219 Ribose-5-phosphate isomerase A; D-ribose 5-phosphate is 6e-53
1uj6_A227 Ribose 5-phosphate isomerase; enzyme-inhibitor complex, 3e-51
2f8m_A244 Ribose 5-phosphate isomerase; structural genomics, PSI, 2e-49
1xtz_A264 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyc 1e-46
2pjm_A226 Ribose-5-phosphate isomerase A; 3D-structure, structura 2e-46
>1lk5_A D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} SCOP: c.124.1.4 d.58.40.1 PDB: 1lk7_A* Length = 229 Back     alignment and structure
 Score =  216 bits (552), Expect = 3e-57
 Identities = 90/227 (39%), Positives = 134/227 (59%), Gaps = 7/227 (3%)

Query: 1   MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANG--FRVQVIPSSRNT 58
           M+  +MK+ AA+ A++++ D M +G+GTGST   F+ LL +K+  G    +  +P+S   
Sbjct: 1   MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQA 60

Query: 59  ENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVI 118
           +     H IP+ S + V ++D+++DG DE+D  L LIKG G AL  EKII + A  FIV+
Sbjct: 61  KLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVL 120

Query: 119 GDESKRVDFLGRGM-LPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGG 177
            DE K VD+L + M +PIE+        +  L      F    ELR+  N  G  ++D G
Sbjct: 121 VDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSI----FNAKAELRMGVNKDGPVITDNG 176

Query: 178 NYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDG 224
           N+I+DA F  I DP  +  EL  IPGVIE+G+F ++ D  I+GT +G
Sbjct: 177 NFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREG 223


>1o8b_A Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} SCOP: c.124.1.4 d.58.40.1 PDB: 1lkz_A 1ks2_A* 3enq_A 3env_A* 3enw_A* Length = 219 Back     alignment and structure
>3kwm_A Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structural genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Length = 224 Back     alignment and structure
>3hhe_A Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str} Length = 255 Back     alignment and structure
>1m0s_A Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} SCOP: c.124.1.4 d.58.40.1 Length = 219 Back     alignment and structure
>1uj6_A Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} SCOP: c.124.1.4 d.58.40.1 PDB: 1uj5_A* 1uj4_A* Length = 227 Back     alignment and structure
>2f8m_A Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7} Length = 244 Back     alignment and structure
>1xtz_A Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Length = 264 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
1lk5_A229 D-ribose-5-phosphate isomerase; alpha/beta structure; 1 100.0
2f8m_A244 Ribose 5-phosphate isomerase; structural genomics, PSI, 100.0
1xtz_A264 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyc 100.0
2pjm_A226 Ribose-5-phosphate isomerase A; 3D-structure, structura 100.0
1m0s_A219 Ribose-5-phosphate isomerase A; D-ribose 5-phosphate is 100.0
1uj6_A227 Ribose 5-phosphate isomerase; enzyme-inhibitor complex, 100.0
3kwm_A224 Ribose-5-phosphate isomerase A; structural genomics, ID 100.0
1o8b_A219 Ribose 5-phosphate isomerase; RPIA, PSI, protein struct 100.0
3hhe_A255 Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, 100.0
3efb_A266 Probable SOR-operon regulator; alpha-beta-alpha sandwic 95.89
3ecs_A315 Translation initiation factor EIF-2B subunit alpha; euk 97.34
1vb5_A276 Translation initiation factor EIF-2B; 2.20A {Pyrococcus 97.32
3a11_A338 Translation initiation factor EIF-2B, delta subunit; is 97.22
1t5o_A351 EIF2BD, translation initiation factor EIF2B, subunit de 96.74
1t9k_A347 Probable methylthioribose-1-phosphate isomerase; struct 96.36
1poi_B260 Glutaconate coenzyme A-transferase; COA, glutamate, pro 96.35
3d3u_A 439 4-hydroxybutyrate COA-transferase; alpha-beta protein, 95.19
2oas_A 436 ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha b 94.88
2yvk_A374 Methylthioribose-1-phosphate isomerase; methionine salv 94.79
3gk7_A 448 4-hydroxybutyrate COA-transferase; alpha/beta protein; 94.77
2nvv_A 506 Acetyl-COA hydrolase/transferase family protein; alpha 91.91
1k6d_A220 Acetate COA-transferase alpha subunit; structural genom 95.84
2ahu_A 531 Putative enzyme YDIF; COA transferase, glutamyl thioest 95.8
2gnp_A266 Transcriptional regulator; structural genomics, MCSG, A 95.67
3nze_A267 Putative transcriptional regulator, sugar-binding; stru 95.5
3kv1_A267 Transcriptional repressor; alpha-beta structure, struct 95.33
2okg_A255 Central glycolytic gene regulator; alpha/beta/alpha san 94.65
2w48_A315 Sorbitol operon regulator; SORC, activator, repressor, 94.08
2o0m_A345 Transcriptional regulator, SORC family; structural geno 93.75
2r5f_A264 Transcriptional regulator, putative; transcription regu 95.06
>1lk5_A D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} SCOP: c.124.1.4 d.58.40.1 PDB: 1lk7_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=558.71  Aligned_cols=226  Identities=40%  Similarity=0.648  Sum_probs=219.2

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHCC--CEEEEEECHHHHHHHHHHCCCCCCCCCCCCEE
Q ss_conf             9878999999999998389978998879178999999999987328--70489618899999987315786551008800
Q gi|254781054|r    1 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANG--FRVQVIPSSRNTENFCKIHHIPLHSPEDVSSV   78 (231)
Q Consensus         1 M~~~~~K~~~a~~A~~~v~~gmviGlGtGSTv~~~i~~L~~~~~~~--~~i~~v~tS~~t~~~a~~~gi~~~~l~~~~~i   78 (231)
                      ||++++|++||++|++||++||+||||||||+++||++|+++++++  .++++||||.+|+.+|+++|||+.+++++++|
T Consensus         1 M~~~~~K~~aA~~A~~~V~~gmvvGLGtGsTv~~~i~~L~~~~~~~~l~~i~~V~tS~~t~~~a~~~gi~~~~~~~~~~i   80 (229)
T 1lk5_A            1 MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAI   80 (229)
T ss_dssp             CCHHHHHHHHHHHHGGGCCTTCEEEECCSHHHHHHHHHHHHHHHTTSSCSCEEEESSHHHHHHHHHTTCCBCCGGGCSCE
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHCCCCCCCCCCCCCE
T ss_conf             99899999999999964799999995864899999999999875255565078745699999999779945441225641


Q ss_pred             EEEECCHHCCCCCCEEEECCCHHHHHHHHHHHHHCCEEEEEEHHHCCCCCC-CCCCCEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             798633000476605883165777778799861022699962303513455-7887267872575899999986322148
Q gi|254781054|r   79 DLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLG-RGMLPIEIDQFGVNKTLSALKEVASCFG  157 (231)
Q Consensus        79 Di~iDGaDevd~~l~lIKGgGgAl~rEKiva~~a~~~I~i~D~sK~v~~Lg-~~plPVEV~p~~~~~v~~~l~~~~~~~G  157 (231)
                      |+|||||||||+++|+||||||||+|||++|++|++||||+|+||+|++|| +|||||||+||+|.++.+.++    .+|
T Consensus        81 Dv~iDGaDevd~~l~liKGGGGal~rEKivA~~a~~~i~I~D~~K~v~~Lg~~~plpvEV~p~~~~~v~~~l~----~~g  156 (229)
T 1lk5_A           81 DVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELS----IFN  156 (229)
T ss_dssp             EEEEECCSEECTTCCEECCTTSCHHHHHHHHHTEEEEEEEEEGGGBCSSTTSSCCEEEEECGGGHHHHHHHGG----GGT
T ss_pred             EEEECCHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCEEECCHHHHHHHHHHH----HHC
T ss_conf             1784162443400576762006788899999853036999742210000578788065876367999999999----728


Q ss_pred             CCCEEEEEECCCCCEECCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEECCEECCCCCEEEEECCCCEEEEEEC
Q ss_conf             98503772258863625788889982079868989999996279968664802476778999779984999879
Q gi|254781054|r  158 LNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK  231 (231)
Q Consensus       158 ~~~~lR~~~~~~gp~iTDnGN~IlD~~~~~i~dp~~le~~L~~IpGVVe~GlF~~~~d~viv~~~dG~~~vl~k  231 (231)
                      +.+++|.+.++++||+|||||||+||+|++|.||.+++.+|++||||||||||.++++.++||+++| +++++|
T Consensus       157 ~~~~lr~~~~~~~p~vTD~GN~IlD~~~~~i~dp~~l~~~L~~ipGVVe~GlF~~~a~~vii~~~~g-v~~i~k  229 (229)
T 1lk5_A          157 AKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREG-VKKLER  229 (229)
T ss_dssp             CEEEECBCSSSSSBCCCTTSCEEEEEECSCCSCHHHHHHHHHTSTTEEEESEECSCCCEEEEEETTE-EEEEEC
T ss_pred             CCCEEEEEECCCCCEECCCCCEEEECCCCCCCCHHHHHHHHHCCCCEEEECEECCCCCEEEEECCCC-EEEEEC
T ss_conf             9955977753899637369986996788997999999999878986996486578699999971990-799719



>2f8m_A Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7} Back     alignment and structure
>1xtz_A Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1m0s_A Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} SCOP: c.124.1.4 d.58.40.1 Back     alignment and structure
>1uj6_A Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} SCOP: c.124.1.4 d.58.40.1 PDB: 1uj5_A* 1uj4_A* Back     alignment and structure
>3kwm_A Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structural genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Back     alignment and structure
>1o8b_A Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} SCOP: c.124.1.4 d.58.40.1 PDB: 1lkz_A 1ks2_A* 3enq_A 3env_A* 3enw_A* Back     alignment and structure
>3hhe_A Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str} Back     alignment and structure
>3efb_A Probable SOR-operon regulator; alpha-beta-alpha sandwich, center for structural genomics of infectious diseases, csgid, transcription; HET: MSE; 2.00A {Shigella flexneri 2a str} SCOP: c.124.1.8 Back     alignment and structure
>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Back     alignment and structure
>1vb5_A Translation initiation factor EIF-2B; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.124.1.5 Back     alignment and structure
>3a11_A Translation initiation factor EIF-2B, delta subunit; isomerase, hexamer, rossmann fold; 2.50A {Thermococcus kodakaraensis} Back     alignment and structure
>1t5o_A EIF2BD, translation initiation factor EIF2B, subunit delta; structural genomics, PSI, protein structure initiative; 1.90A {Archaeoglobus fulgidus dsm 4304} SCOP: c.124.1.5 Back     alignment and structure
>1t9k_A Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} SCOP: c.124.1.5 Back     alignment and structure
>1poi_B Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} SCOP: c.124.1.3 Back     alignment and structure
>3d3u_A 4-hydroxybutyrate COA-transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Porphyromonas gingivalis W83} Back     alignment and structure
>2oas_A ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein structure initiative; HET: COA; 2.40A {Shewanella oneidensis mr-1} Back     alignment and structure
>2yvk_A Methylthioribose-1-phosphate isomerase; methionine salvage pathway,; HET: MRU; 2.40A {Bacillus subtilis} PDB: 2yrf_A* Back     alignment and structure
>3gk7_A 4-hydroxybutyrate COA-transferase; alpha/beta protein; HET: SPD; 1.85A {Clostridium aminobutyricum} Back     alignment and structure
>2nvv_A Acetyl-COA hydrolase/transferase family protein; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Porphyromonas gingivalis} Back     alignment and structure
>1k6d_A Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: c.124.1.2 Back     alignment and structure
>2ahu_A Putative enzyme YDIF; COA transferase, glutamyl thioester, structural genomics, montreal-kingston bacterial structural genomics initiative; 1.90A {Escherichia coli O157} SCOP: c.124.1.3 c.124.1.2 PDB: 2ahv_A* 2ahw_A* Back     alignment and structure
>2gnp_A Transcriptional regulator; structural genomics, MCSG, APC84799, PSI, protein structure initiative; 1.65A {Streptococcus pneumoniae TIGR4} SCOP: c.124.1.8 Back     alignment and structure
>3nze_A Putative transcriptional regulator, sugar-binding; structural genomics, PSI-2, protein structure initiative; 1.70A {Arthrobacter aurescens TC1} Back     alignment and structure
>3kv1_A Transcriptional repressor; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.70A {Vibrio fischeri ES114} Back     alignment and structure
>2okg_A Central glycolytic gene regulator; alpha/beta/alpha sandwich, rossmann-like fold, structural genomics, PSI-2, protein structure initiative; HET: MSE G3H; 1.65A {Bacillus subtilis} SCOP: c.124.1.8 PDB: 3bxe_A* 3bxf_A* 3bxg_A* 3bxh_A* Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, PSI-2, protein structure initiative; 1.60A {Enterococcus faecalis V583} SCOP: c.124.1.8 Back     alignment and structure
>2r5f_A Transcriptional regulator, putative; transcription regulator, sugar-binding domain, structural genomics, PFAM04198, PSI-2; 2.10A {Pseudomonas syringae PV} SCOP: c.124.1.8 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
d1lk5a1149 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isom 8e-24
d1uj4a1151 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isom 4e-23
d1o8ba1124 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate iso 4e-22
d1m0sa1147 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isom 7e-21
d1lk5a280 d.58.40.1 (A:131-210) D-ribose-5-phosphate isomerase (R 6e-17
d1uj4a274 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (R 1e-15
d1o8ba272 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (R 4e-14
d1m0sa272 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (R 2e-13
>d1lk5a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
domain: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
 Score =  104 bits (260), Expect = 8e-24
 Identities = 58/146 (39%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 1   MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIANGF--RVQVIPSSRNT 58
           M+  +MK+ AA+ A++++ D M +G+GTGST   F+ LL +K+  G    +  +P+S   
Sbjct: 1   MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQA 60

Query: 59  ENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVI 118
           +     H IP+ S + V ++D+++DG DE+D  L LIKG G AL  EKII + A  FIV+
Sbjct: 61  KLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVL 120

Query: 119 GDESKRVDFLGRGMLPIEIDQFGVNK 144
            DE K VD+L    + I   + GV K
Sbjct: 121 VDERKLVDYLDIADIVIVGTREGVKK 146


>d1uj4a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]} Length = 151 Back     information, alignment and structure
>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 124 Back     information, alignment and structure
>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae [TaxId: 727]} Length = 147 Back     information, alignment and structure
>d1lk5a2 d.58.40.1 (A:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 80 Back     information, alignment and structure
>d1uj4a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]} Length = 74 Back     information, alignment and structure
>d1o8ba2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli [TaxId: 562]} Length = 72 Back     information, alignment and structure
>d1m0sa2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Haemophilus influenzae [TaxId: 727]} Length = 72 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
d1o8ba1124 D-ribose-5-phosphate isomerase (RpiA), catalytic domain 100.0
d1uj4a1151 D-ribose-5-phosphate isomerase (RpiA), catalytic domain 99.97
d1lk5a1149 D-ribose-5-phosphate isomerase (RpiA), catalytic domain 99.96
d1m0sa1147 D-ribose-5-phosphate isomerase (RpiA), catalytic domain 99.96
d1vb5a_274 Putative eIF-2B subunit 2-like protein PH0440 {Pyrococc 97.31
d1t5oa_340 Putative eIF-2B delta-subunit {Archaeon Archaeoglobus f 96.94
d1k6da_219 Acetate:CoA transferase alpha {Escherichia coli [TaxId: 96.68
d1poib_260 Glutaconate:CoA transferase beta {Acidaminococcus ferme 96.4
d1t9ka_340 Probable methylthioribose-1-phosphate isomerase TM0911 95.87
d2g39a1221 Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [ 94.57
d2ahua1247 Putative enzyme YdiF C-terminal domain {Escherichia col 93.12
d1lk5a280 D-ribose-5-phosphate isomerase (RpiA), lid domain {Arch 99.93
d1uj4a274 D-ribose-5-phosphate isomerase (RpiA), lid domain {Ther 99.91
d1o8ba272 D-ribose-5-phosphate isomerase (RpiA), lid domain {Esch 99.91
d1m0sa272 D-ribose-5-phosphate isomerase (RpiA), lid domain {Haem 99.89
d2gnpa1262 Transcriptional regulator SP0247 {Streptococcus pneumon 95.99
d3efba1255 Sor-operon regulator SorC {Shigella flexneri [TaxId: 62 95.96
d2okga1250 Central glycolytic gene regulator CggR {Bacillus subtil 95.7
d2o0ma1247 Transcriptional regulator EF1965 {Enterococcus faecalis 95.04
d2r5fa1258 Transcriptional regulator PSPTO2395 {Pseudomonas syring 95.39
d1xr4a2269 Putative citrate lyase alpha chain, citF2 {Salmonella t 93.33
>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
domain: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=308.19  Aligned_cols=121  Identities=37%  Similarity=0.509  Sum_probs=111.8

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHCCCCCCCCCCCCEEEEEECCHHCCCCCCEEEECCCHHH
Q ss_conf             99887917899999999998732870489618899999987315786551008800798633000476605883165777
Q gi|254781054|r   23 TLGMGTGSTAKEFMILLADKIANGFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGAL  102 (231)
Q Consensus        23 viGlGtGSTv~~~i~~L~~~~~~~~~i~~v~tS~~t~~~a~~~gi~~~~l~~~~~iDi~iDGaDevd~~l~lIKGgGgAl  102 (231)
                      +||||||||+.+||++|+++.  +....+||||.+|+.+|+++|||+.++++++++|+|||||||||+++||||||||||
T Consensus         1 VvGlGtGSTv~~~i~~L~~~~--~~~~~~V~tS~~t~~~~~~~gi~~~~l~~~~~iDi~iDGADevd~~l~lIKGGGgal   78 (124)
T d1o8ba1           1 IVGVGTGSTAAHFIDALGTMK--GQIEGAVSSSDASTEKLKSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAAL   78 (124)
T ss_dssp             CEEECCSCC-----------------CCEEESCCC------------CCGGGCSCEEEEEECCSEECTTSCEECCCCC-H
T ss_pred             CEEECCHHHHHHHHHHHHHHH--CCCCEEECCHHHHHHHHHHCCCCCCCHHHCCCEEEEECCHHHCCCCCEEHHHCCCCC
T ss_conf             988645699999999998503--776458747579999999808876671017831698415232277740523277412


Q ss_pred             HHHHHHHHHHCCEEEEEEHHHCCCCCCCCCCCEEE--EECCHHHH
Q ss_conf             77879986102269996230351345578872678--72575899
Q gi|254781054|r  103 LREKIIAHAASRFIVIGDESKRVDFLGRGMLPIEI--DQFGVNKT  145 (231)
Q Consensus       103 ~rEKiva~~a~~~I~i~D~sK~v~~Lg~~plPVEV--~p~~~~~v  145 (231)
                      +|||++|++|++||||+|+||+|++||.||+||||  +|+||+++
T Consensus        79 ~rEKivA~~A~~~i~I~DesK~V~~Lg~~~~PVevev~p~a~~~V  123 (124)
T d1o8ba1          79 TREKIIASVAEKFICIADASKQVDILANRGADVALIGTPDGVKTI  123 (124)
T ss_dssp             HHHHHHHHHEEEEEEEEEGGGBCSSBCSSCCSEEEEEETTEEEEE
T ss_pred             HHHHHHHHHCCCEEEEEECCCEECCCCCCCCCEEEEECCCCHHHC
T ss_conf             278899985683799983872615368878767999764613311



>d1uj4a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lk5a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t5oa_ c.124.1.5 (A:) Putative eIF-2B delta-subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1t9ka_ c.124.1.5 (A:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahua1 c.124.1.3 (A:283-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lk5a2 d.58.40.1 (A:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uj4a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8ba2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m0sa2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnpa1 c.124.1.8 (A:56-317) Transcriptional regulator SP0247 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o0ma1 c.124.1.8 (A:95-341) Transcriptional regulator EF1965 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2r5fa1 c.124.1.8 (A:59-316) Transcriptional regulator PSPTO2395 {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1xr4a2 c.124.1.2 (A:237-505) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 231 ribose-5-phosphate isomerase A [Candidatus Liberib
1lk5_A_229 (A:) D-ribose-5-phosphate isomerase; alpha/beta st 9e-37
2pjm_A_226 (A:) Ribose-5-phosphate isomerase A; 3D-structure, 3e-34
3kwm_A_224 (A:) Ribose-5-phosphate isomerase A; structural ge 3e-30
3hhe_A_148-23487 (A:148-234) Ribose-5-phosphate isomerase A; niaid, 9e-24
1uj6_A_131-21080 (A:131-210) Ribose 5-phosphate isomerase; enzyme-i 1e-19
2f8m_A_140-22384 (A:140-223) Ribose 5-phosphate isomerase; structur 4e-19
1xtz_A_153-24088 (A:153-240) Ribose-5-phosphate isomerase; yeast; 2 1e-18
1m0s_A_126-20277 (A:126-202) Ribose-5-phosphate isomerase A; D-ribo 2e-15
1o8b_A_128-20174 (A:128-201) Ribose 5-phosphate isomerase; RPIA, PS 3e-15
3hhe_A_1-147_235-255168 (A:1-147,A:235-255) Ribose-5-phosphate isomerase A 2e-20
1o8b_A_1-127_202-219145 (A:1-127,A:202-219) Ribose 5-phosphate isomerase; 2e-18
1uj6_A_1-130_211-227147 (A:1-130,A:211-227) Ribose 5-phosphate isomerase; 1e-17
1xtz_A_1-152_241-264176 (A:1-152,A:241-264) Ribose-5-phosphate isomerase; 6e-17
1m0s_A_1-125_203-219142 (A:1-125,A:203-219) Ribose-5-phosphate isomerase A 1e-16
2f8m_A_1-139_224-244160 (A:1-139,A:224-244) Ribose 5-phosphate isomerase; 3e-16
3ecs_A_106-315210 (A:106-315) Translation initiation factor EIF-2B s 2e-04
3fho_A_1-326326 (A:1-326) ATP-dependent RNA helicase DBP5; mRNA ex 0.003
>1lk5_A (A:) D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii}Length = 229 Back     alignment and structure
 Score =  147 bits (373), Expect = 9e-37
 Identities = 89/227 (39%), Positives = 132/227 (58%), Gaps = 7/227 (3%)

Query: 1   MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADK--IANGFRVQVIPSSRNT 58
           M+  +MK+ AA+ A++++ D M +G+GTGST   F+ LL +K        +  +P+S   
Sbjct: 1   MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQA 60

Query: 59  ENFCKIHHIPLHSPEDVSSVDLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVI 118
           +     H IP+ S + V ++D+++DG DE+D  L LIKG G AL  EKII + A  FIV+
Sbjct: 61  KLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVL 120

Query: 119 GDESKRVDFLG-RGMLPIEIDQFGVNKTLSALKEVASCFGLNEELRLRRNGSGLFVSDGG 177
            DE K VD+L  +  +PIE+        +  L    S F    ELR+  N  G  ++D G
Sbjct: 121 VDERKLVDYLCQKMPVPIEVIPQAWKAIIEEL----SIFNAKAELRMGVNKDGPVITDNG 176

Query: 178 NYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDG 224
           N+I+DA F  I DP  +  EL  IPGVIE+G+F ++ D  I+GT +G
Sbjct: 177 NFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREG 223


>3kwm_A (A:) Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structural genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp}Length = 224 Back     alignment and structure
>3hhe_A (A:148-234) Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str}Length = 87 Back     alignment and structure
>1uj6_A (A:131-210) Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus}Length = 80 Back     alignment and structure
>2f8m_A (A:140-223) Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7}Length = 84 Back     alignment and structure
>1xtz_A (A:153-240) Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae}Length = 88 Back     alignment and structure
>1m0s_A (A:126-202) Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae}Length = 77 Back     alignment and structure
>1o8b_A (A:128-201) Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli}Length = 74 Back     alignment and structure
>3hhe_A (A:1-147,A:235-255) Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str}Length = 168 Back     alignment and structure
>1o8b_A (A:1-127,A:202-219) Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli}Length = 145 Back     alignment and structure
>1uj6_A (A:1-130,A:211-227) Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus}Length = 147 Back     alignment and structure
>1xtz_A (A:1-152,A:241-264) Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae}Length = 176 Back     alignment and structure
>1m0s_A (A:1-125,A:203-219) Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae}Length = 142 Back     alignment and structure
>2f8m_A (A:1-139,A:224-244) Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7}Length = 160 Back     alignment and structure
>3ecs_A (A:106-315) Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens}Length = 210 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target231 ribose-5-phosphate isomerase A [Candidatus Liberibacter
1lk5_A_229 D-ribose-5-phosphate isomerase; alpha/beta structu 100.0
2pjm_A_226 Ribose-5-phosphate isomerase A; 3D-structure, stru 100.0
3kwm_A_224 Ribose-5-phosphate isomerase A; structural genomic 100.0
3ecs_A_106-315210 Translation initiation factor EIF-2B subunit alpha 99.14
3hhe_A_148-23487 Ribose-5-phosphate isomerase A; niaid, ssgcid, dec 99.96
2f8m_A_140-22384 Ribose 5-phosphate isomerase; structural genomics, 99.94
1xtz_A_153-24088 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccha 99.94
1uj6_A_131-21080 Ribose 5-phosphate isomerase; enzyme-inhibitor com 99.94
1m0s_A_126-20277 Ribose-5-phosphate isomerase A; D-ribose 5-phospha 99.92
1o8b_A_128-20174 Ribose 5-phosphate isomerase; RPIA, PSI, protein s 99.91
3hhe_A_1-147_235-255168 Ribose-5-phosphate isomerase A; niaid, ssgcid, dec 99.78
1m0s_A_1-125_203-219142 Ribose-5-phosphate isomerase A; D-ribose 5-phospha 99.77
1o8b_A_1-127_202-219145 Ribose 5-phosphate isomerase; RPIA, PSI, protein s 99.72
1xtz_A_1-152_241-264176 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccha 99.68
1uj6_A_1-130_211-227147 Ribose 5-phosphate isomerase; enzyme-inhibitor com 99.65
2f8m_A_1-139_224-244160 Ribose 5-phosphate isomerase; structural genomics, 99.64
3cdk_B_219 Succinyl-COA:3-ketoacid-coenzyme A transferase sub 98.3
1ooy_A_249-481233 Succinyl-COA:3-ketoacid-coenzyme A transferase, mi 98.03
1poi_B_260 Glutaconate coenzyme A-transferase; COA, glutamate 97.97
1vb5_A_276 Translation initiation factor EIF-2B; 2.20A {Pyroc 97.57
1k6d_A_1-99_149-220171 Acetate COA-transferase alpha subunit; structural 97.09
1t9k_A_114-347234 Probable methylthioribose-1-phosphate isomerase; s 96.72
2oas_A_1-181181 ATOA, 4-hydroxybutyrate coenzyme A transferase; al 96.21
3gk7_A_1-187187 4-hydroxybutyrate COA-transferase; alpha/beta prot 96.14
3eh7_A_1-190190 4-hydroxybutyrate COA-transferase; citrate lyase, 96.13
3d3u_A_1-187187 4-hydroxybutyrate COA-transferase; alpha-beta prot 96.12
3cdk_A_241 Succinyl-COA:3-ketoacid-coenzyme A transferase sub 96.05
1t5o_A_144-351208 EIF2BD, translation initiation factor EIF2B, subun 95.78
1xr4_A_120-157_239-509309 Putative citrate lyase alpha chain/citrate-ACP tra 95.65
1poi_A_1-116_171-243189 Glutaconate coenzyme A-transferase; COA, glutamate 95.64
2yvk_A_374 Methylthioribose-1-phosphate isomerase; methionine 95.17
2nvv_A_221-506286 Acetyl-COA hydrolase/transferase family protein; a 94.62
2nvv_A_1-220220 Acetyl-COA hydrolase/transferase family protein; a 94.04
2g39_A_1-225225 Acetyl-COA hydrolase; coenzyme A transferase, stru 92.65
1xr4_A_26-119_158-238175 Putative citrate lyase alpha chain/citrate-ACP tra 92.46
2a0u_A_383 Initiation factor 2B; SGPP, structural genomics, P 92.33
3eh7_A_191-434244 4-hydroxybutyrate COA-transferase; citrate lyase, 96.44
3gk7_A_188-448261 4-hydroxybutyrate COA-transferase; alpha/beta prot 94.54
2oas_A_182-436255 ATOA, 4-hydroxybutyrate coenzyme A transferase; al 94.22
2okg_A_255 Central glycolytic gene regulator; alpha/beta/alph 93.64
3d3u_A_188-439252 4-hydroxybutyrate COA-transferase; alpha-beta prot 93.44
3kv1_A_267 Transcriptional repressor; alpha-beta structure, s 93.1
2ri0_A_234 Glucosamine-6-phosphate deaminase; carbohydrate me 92.16
3efb_A_266 Probable SOR-operon regulator; alpha-beta-alpha sa 90.69
2gnp_A_266 Transcriptional regulator; structural genomics, MC 92.65
1ooy_A_1-248248 Succinyl-COA:3-ketoacid-coenzyme A transferase, mi 92.09
>1lk5_A (A:) D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} Back     alignment and structure
Probab=100.00  E-value=0  Score=401.27  Aligned_cols=226  Identities=39%  Similarity=0.629  Sum_probs=215.1

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHHHHC--CCEEEEEECHHHHHHHHHHCCCCCCCCCCCCEE
Q ss_conf             987899999999999838997899887917899999999998732--870489618899999987315786551008800
Q gi|254781054|r    1 MDALQMKRNAARRAIQYVVDGMTLGMGTGSTAKEFMILLADKIAN--GFRVQVIPSSRNTENFCKIHHIPLHSPEDVSSV   78 (231)
Q Consensus         1 M~~~~~K~~~a~~A~~~v~~gmviGlGtGSTv~~~i~~L~~~~~~--~~~i~~v~tS~~t~~~a~~~gi~~~~l~~~~~i   78 (231)
                      |++.++|+.+|++|++||++||+||||||||+.+|+++|+++...  ..+..++++|..+...+..+|++..++.+..++
T Consensus         1 m~~~~~K~~iA~~A~~~I~dg~~I~lgsGST~~~li~~L~~~~~~~~~t~~v~v~gg~~~~~~~~~~G~~~~~~~~~~~~   80 (229)
T 1lk5_A            1 MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAI   80 (229)
T ss_dssp             CCHHHHHHHHHHHHGGGCCTTCEEEECCSHHHHHHHHHHHHHHHTTSSCSCEEEESSHHHHHHHHHTTCCBCCGGGCSCE
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHCCCCCCCCCCCCCE
T ss_conf             99899999999999964799999994825999999999998765255565088755689999999779945342335742


Q ss_pred             EEEECCHHCCCCCCEEEECCCHHHHHHHHHHHHHCCEEEEEEHHHCCCCCC-CCCCCEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             798633000476605883165777778799861022699962303513455-7887267872575899999986322148
Q gi|254781054|r   79 DLSIDGFDEIDSRLRLIKGYGGALLREKIIAHAASRFIVIGDESKRVDFLG-RGMLPIEIDQFGVNKTLSALKEVASCFG  157 (231)
Q Consensus        79 Di~iDGaDevd~~l~lIKGgGgAl~rEKiva~~a~~~I~i~D~sK~v~~Lg-~~plPVEV~p~~~~~v~~~l~~~~~~~G  157 (231)
                      |+||||||++|++++++||+|+++++||+++++|+++|+++|+||++.+++ +||+|+||.||+|..+.+.+..    .|
T Consensus        81 D~af~Gad~i~~~~gl~~~~~~~~~~ek~~~~~s~~~IilaD~sK~~~~~~~~~~~~~eV~~~~~~~~~~~~~~----~~  156 (229)
T 1lk5_A           81 DVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSI----FN  156 (229)
T ss_dssp             EEEEECCSEECTTCCEECCTTSCHHHHHHHHHTEEEEEEEEEGGGBCSSTTSSCCEEEEECGGGHHHHHHHGGG----GT
T ss_pred             EEEECCCHHHCCCCEEEEECCHHHHHHHHHHHHCCCEEEEECCCCEEHHCCCCCCCCEEECCHHHHHHHHHHHH----HC
T ss_conf             27850602206663389706078888999998443569997522100113777880558652789999999997----28


Q ss_pred             CCCEEEEEECCCCCEECCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEECCEECCCCCEEEEECCCCEEEEEEC
Q ss_conf             98503772258863625788889982079868989999996279968664802476778999779984999879
Q gi|254781054|r  158 LNEELRLRRNGSGLFVSDGGNYIVDAFFGFIPDPQIISGELCNIPGVIEHGLFINMVDCAIIGTSDGECLVLQK  231 (231)
Q Consensus       158 ~~~~lR~~~~~~gp~iTDnGN~IlD~~~~~i~dp~~le~~L~~IpGVVe~GlF~~~~d~viv~~~dG~~~vl~k  231 (231)
                      ..+.+|...++.+|++|||||+|+|++|+++.||.+++.+|++||||||||||.++++.+++|+++| +++++|
T Consensus       157 ~~~~~R~~~~~~g~~itd~Gn~i~D~~~~~~~~~~~~~~~l~~i~Gvve~g~f~~~~~~~~~~~~~~-~~~~~k  229 (229)
T 1lk5_A          157 AKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREG-VKKLER  229 (229)
T ss_dssp             CEEEECBCSSSSSBCCCTTSCEEEEEECSCCSCHHHHHHHHHTSTTEEEESEECSCCCEEEEEETTE-EEEEEC
T ss_pred             CCCEEEEEECCCCCEECCCCCEEEECCCCCCCCHHHHHHHHHCCCCEEEECEECCCCCEEEEECCCE-EEEEEC
T ss_conf             9956987634899507369986996778997999999999878997997586578798999971990-799719



>3kwm_A (A:) Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structural genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Back     alignment and structure
>3ecs_A (A:106-315) Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Back     alignment and structure
>3hhe_A (A:148-234) Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str} Back     alignment and structure
>2f8m_A (A:140-223) Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7} Back     alignment and structure
>1xtz_A (A:153-240) Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1uj6_A (A:131-210) Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} Back     alignment and structure
>1m0s_A (A:126-202) Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} Back     alignment and structure
>1o8b_A (A:128-201) Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} Back     alignment and structure
>3hhe_A (A:1-147,A:235-255) Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, structural genomics; HET: 5RP; 2.30A {Bartonella henselae str} Back     alignment and structure
>1m0s_A (A:1-125,A:203-219) Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} Back     alignment and structure
>1o8b_A (A:1-127,A:202-219) Ribose 5-phosphate isomerase; RPIA, PSI, protein structure initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} Back     alignment and structure
>1xtz_A (A:1-152,A:241-264) Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1uj6_A (A:1-130,A:211-227) Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} Back     alignment and structure
>2f8m_A (A:1-139,A:224-244) Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative; 2.09A {Plasmodium falciparum 3D7} Back     alignment and structure
>3cdk_B (B:) Succinyl-COA:3-ketoacid-coenzyme A transferase subunit B; CO-expressed complex, hetero-tetramer, structural genomics, PSI-2; 2.59A {Bacillus subtilis} Back     alignment and structure
>1ooy_A (A:249-481) Succinyl-COA:3-ketoacid-coenzyme A transferase, mitochondrial precursor; alpha/beta protein; 1.70A {Sus scrofa} Back     alignment and structure
>1poi_B (B:) Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} Back     alignment and structure
>1vb5_A (A:) Translation initiation factor EIF-2B; 2.20A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1k6d_A (A:1-99,A:149-220) Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} Back     alignment and structure
>1t9k_A (A:114-347) Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} Back     alignment and structure
>2oas_A (A:1-181) ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein structure initiative; HET: COA; 2.40A {Shewanella oneidensis mr-1} Back     alignment and structure
>3gk7_A (A:1-187) 4-hydroxybutyrate COA-transferase; alpha/beta protein; HET: SPD; 1.85A {Clostridium aminobutyricum} Back     alignment and structure
>3eh7_A (A:1-190) 4-hydroxybutyrate COA-transferase; citrate lyase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Porphyromonas gingivalis} Back     alignment and structure
>3d3u_A (A:1-187) 4-hydroxybutyrate COA-transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.80A {Porphyromonas gingivalis W83} Back     alignment and structure
>3cdk_A (A:) Succinyl-COA:3-ketoacid-coenzyme A transferase subunit A; CO-expressed complex, hetero-tetramer, structural genomics, PSI-2; 2.59A {Bacillus subtilis} Back     alignment and structure
>1t5o_A (A:144-351) EIF2BD, translation initiation factor EIF2B, subunit delta; structural genomics, PSI, protein structure initiative; 1.90A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>1xr4_A (A:120-157,A:239-509) Putative citrate lyase alpha chain/citrate-ACP transferase; the midwest center for structural genomics, MCSG, structural genomics; 2.37A {Salmonella typhimurium LT2} Back     alignment and structure
>1poi_A (A:1-116,A:171-243) Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} Back     alignment and structure
>2yvk_A (A:) Methylthioribose-1-phosphate isomerase; methionine salvage pathway,; HET: MRU; 2.40A {Bacillus subtilis} PDB: 2yrf_A* Back     alignment and structure
>2nvv_A (A:221-506) Acetyl-COA hydrolase/transferase family protein; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Porphyromonas gingivalis W83} Back     alignment and structure
>2nvv_A (A:1-220) Acetyl-COA hydrolase/transferase family protein; alpha beta protein, structural genomics, PSI-2, protein structure initiative; 2.70A {Porphyromonas gingivalis W83} Back     alignment and structure