254781055

254781055

glutathione reductase

GeneID in NCBI database:8210078Locus tag:CLIBASIA_04785
Protein GI in NCBI database:254781055Protein Accession:YP_003065468.1
Gene range:+(1059788, 1061173)Protein Length:461aa
Gene description:glutathione reductase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
KEGG prediction:gor; glutathione reductase (EC:1.8.1.7); K00383 glutathione reductase (NADPH) [EC:1.8.1.7]
SEED prediction:Glutathione reductase (EC 1.8.1.7)
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Glutathione: Redox cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
ccccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccEEEEEcccEEEEEcccEEEEccccEEcccccccccccccccEEEccHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEcccEEEEccEEEEccccccccccccHHHcccEEcccccEEEccccccccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEccccHHHHHHccccEEEEEEEcccccHHHcccccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcc
ccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHccHHHHHHHHHHHHHHHHHHHcHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEccccccEEEEccEEEEcccEEEcccEEEcccccccHHHcEcHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEcccccEEEEEccccEEEEcEEEEcccEEEccHHHcHHHHcccEcccccEccccccEcccccEEEcHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEEccHHHHHccccEEEEEEEEEcccHHHccccccEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHcccEHHHHHcccccccccHHHHHccccccEEEEccEEEcc
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEyrvggtcvirgcipkkLMFYASQYSEyfedsqgfgwsvdhksfdWQSLITAQNKELSRLESFYHNRLESAGVeifaskgilssphsvYIANLNRTITSRYIVVstggspnrmdfkgsdlcitsdeifslkslpqstliigGGYIAVEFAGILnslgskttlvtrgnsilskfdsdIRQGLTDVMISrgmqvfhndTIESVVSESGQLKSIlksgkivktdqvilavgrtprttgiglekvgvkmdengfiitdcysrtnvqsifslgdisghiqltPVAIHAAACFVEtvfkdnptipdydlvptavfskpeiasvgltEEEAVQKFCRLEiyktkffpmkcflskRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKagcvkkdfdrcmavhptsseelvtmynpqylIENGIKQVL
mryeydlvvigagssgvrsARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVstggspnrmdFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRgnsilskfdsdiRQGLTDVMISRGMQVFHNDTIESVVSESGQLKsilksgkivktdqvilavgrtprttgiglekvgvkmdENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHptsseelvtmynpqYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIE*******
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
*RYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 2e-49
254781053466 dihydrolipoamide dehydrogenase [Candidatus Liberib 1e-46
>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score =  188 bits (477), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 131/469 (27%), Positives = 232/469 (49%), Gaps = 28/469 (5%)

Query: 1   MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYS 60
           M   YD+++IG+G +G  +A  AAQLG KVAI E   +GG C+  GCIP K +  +++  
Sbjct: 1   MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEIL 60

Query: 61  EYFEDSQGFGWSVDHK-SFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSP 119
           ++ +++Q +G +V  K  F+ + ++        RL       +    V+I   K  L +P
Sbjct: 61  DHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNP 120

Query: 120 HSVYIANLNR-----------------TITSRYIVVSTGGSPNRMDF--KGSDLCITSDE 160
             + ++  ++                 T  +++I+++TG  P  ++     S L  T  +
Sbjct: 121 SEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFD 180

Query: 161 IFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMI 220
                  P+S +++G G I VEF+    SL    +L+   + IL   DS+I Q +   + 
Sbjct: 181 ALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQ 240

Query: 221 SRGMQVFHNDTIESVVSESGQLKSI---LKSGKI--VKTDQVILAVGRTPRTTGIGLEKV 275
            RG+++     I S V + G + S+    K G +  ++ ++++L+ G       IGLEK+
Sbjct: 241 KRGIKILTESKISS-VKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKI 299

Query: 276 GVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIP-D 334
           GVK   NG II D Y RTNV  I+++GD++G   L   A H     +E +   +   P D
Sbjct: 300 GVKTS-NGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLD 358

Query: 335 YDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHA 394
              +P   +  P++AS+GLTEE+A  +   + + K  F      ++   +  ++K I + 
Sbjct: 359 KSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNN 418

Query: 395 DNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443
              +VLGVH++G E +E+IQ   + +     +++    +  HPT SE +
Sbjct: 419 KTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETM 467

>gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Back     alignment
 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 137/467 (29%), Positives = 230/467 (49%), Gaps = 45/467 (9%)

Query: 5   YDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRV-GGTCVIRGCIPKKLMFYASQ-YSEY 62
           YD+ V+G G +G   A  AAQL  KVAI E+ +  GGTC+  GCIP K + +AS+ YS  
Sbjct: 3   YDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHI 62

Query: 63  FEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPH-S 121
            +++   G ++     D + +++ +    S +ES       + G+     K  + + H S
Sbjct: 63  AKEAGDLGINIASCHLDLKKMMSYKK---SIVES------NTQGINFLLKKNKIITYHGS 113

Query: 122 VYIANLNR----------TITSRYIVVSTG----GSPN-RMDFKGSDLCITSDEIFSLKS 166
             I + N+          TI ++ IV++TG    G P   +DF    + ++S    S  S
Sbjct: 114 ARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFD-EQVIVSSTGALSFSS 172

Query: 167 LPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQV 226
           +P++ L+IG G I +E   +   LGS   ++    +IL+  D +I      +M  +GM  
Sbjct: 173 VPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNF 232

Query: 227 FHNDTIESVVSESGQLKSILKSGK----IVKTDQVILAVGRTPRTTGIGLEKVGVKMDEN 282
             N  + SV    G+ + + +S       ++ D V++A GR P T G+GLE++G+ +D  
Sbjct: 233 QLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHR 292

Query: 283 GFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAA---ACFVETVFKDNPTIPDYDLVP 339
           G I      +T++ +I+++GD+       P+  H A      V  +        +Y ++P
Sbjct: 293 GCIEIGGQFQTSISTIYAIGDVV----RGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIP 348

Query: 340 TAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTI---MKIIVHADN 396
           + V++ PE+AS+G TEE   Q  C  + YK   FP       R  ++I   +KI+ +  +
Sbjct: 349 SVVYTHPEVASIGKTEE---QLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKS 405

Query: 397 HKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443
            +V GVHI+G  A E+I    V ++ G   +D  R    HPT SE +
Sbjct: 406 DRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAV 452

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
315122393461 glutathione reductase [Candidatus Liberibacter solanace 1 0.0
222148538462 glutathione reductase [Agrobacterium vitis S4] Length = 1 1e-152
222086213461 glutathione-disulfide reductase [Agrobacterium radiobac 1 1e-151
190892055461 glutathione reductase [Rhizobium etli CIAT 652] Length 1 1e-150
152980459462 glutathione reductase [Janthinobacterium sp. Marseille] 1 1e-150
86357992461 glutathione reductase [Rhizobium etli CFN 42] Length = 1 1e-149
325293001462 glutathione reductase [Agrobacterium sp. H13-3] Length 1 1e-149
163759647462 glutathione reductase [Hoeflea phototrophica DFL-43] Le 1 1e-146
209549602461 glutathione reductase [Rhizobium leguminosarum bv. trif 1 1e-145
15965607463 glutathione reductase [Sinorhizobium meliloti 1021] Len 1 1e-145
>gi|315122393|ref|YP_004062882.1| glutathione reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 461 Back     alignment and organism information
 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/459 (78%), Positives = 418/459 (91%)

Query: 1   MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYS 60
           M YEYDL+VIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGC+PKKLMFYASQYS
Sbjct: 1   MLYEYDLIVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCVPKKLMFYASQYS 60

Query: 61  EYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPH 120
           ++FEDS+GFGWSV ++SFDW SLI  Q+KELSRLESFYH+RL+SAGVEI  S+ ILSSPH
Sbjct: 61  DHFEDSKGFGWSVGYQSFDWPSLIAEQDKELSRLESFYHDRLDSAGVEILKSRAILSSPH 120

Query: 121 SVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIA 180
            VY+AN++RTIT++YIVV+TGGSP+RMDF+G +LCITS+E+FSL+SLPQS LI+GGGYIA
Sbjct: 121 EVYLANVDRTITAQYIVVATGGSPDRMDFEGCNLCITSEEVFSLESLPQSILIVGGGYIA 180

Query: 181 VEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESG 240
           VEFA I N+LGSKTTLVTRGNSILS+FD D+RQGLT++M S+G+++  N+T +SV SESG
Sbjct: 181 VEFACIFNALGSKTTLVTRGNSILSRFDVDMRQGLTEIMNSKGIRIISNNTPKSVFSESG 240

Query: 241 QLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFS 300
            LKSIL+S +I+ TDQV+LAVGR PRT  IGL+K+GV MD NGFI+TD YSRTN+ SIF+
Sbjct: 241 HLKSILESEEIIMTDQVMLAVGRKPRTMDIGLDKLGVAMDANGFIVTDRYSRTNIDSIFA 300

Query: 301 LGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQ 360
            GDISG  QLTPVAIHAAACFVETVFKDNPT PDYDL+PTAVFS+PEI+SVGLTEEEA  
Sbjct: 301 FGDISGQAQLTPVAIHAAACFVETVFKDNPTSPDYDLIPTAVFSQPEISSVGLTEEEATH 360

Query: 361 KFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCL 420
           +F RLEIYKTKFFP+K FLSKRFEHTIMKIIV+ADN KVLGVHILG E+SEIIQVLG+CL
Sbjct: 361 QFPRLEIYKTKFFPIKSFLSKRFEHTIMKIIVNADNRKVLGVHILGSESSEIIQVLGICL 420

Query: 421 KAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQ 459
           K+GCVK+DFDRCMAVHPT++EELVTMY+P YLIE GIK+
Sbjct: 421 KSGCVKEDFDRCMAVHPTATEELVTMYHPSYLIEEGIKK 459


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148538|ref|YP_002549495.1| glutathione reductase [Agrobacterium vitis S4] Length = 462 Back     alignment and organism information
>gi|222086213|ref|YP_002544745.1| glutathione-disulfide reductase [Agrobacterium radiobacter K84] Length = 461 Back     alignment and organism information
>gi|190892055|ref|YP_001978597.1| glutathione reductase [Rhizobium etli CIAT 652] Length = 461 Back     alignment and organism information
>gi|152980459|ref|YP_001352656.1| glutathione reductase [Janthinobacterium sp. Marseille] Length = 462 Back     alignment and organism information
>gi|86357992|ref|YP_469884.1| glutathione reductase [Rhizobium etli CFN 42] Length = 461 Back     alignment and organism information
>gi|325293001|ref|YP_004278865.1| glutathione reductase [Agrobacterium sp. H13-3] Length = 462 Back     alignment and organism information
>gi|163759647|ref|ZP_02166732.1| glutathione reductase [Hoeflea phototrophica DFL-43] Length = 462 Back     alignment and organism information
>gi|209549602|ref|YP_002281519.1| glutathione reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 461 Back     alignment and organism information
>gi|15965607|ref|NP_385960.1| glutathione reductase [Sinorhizobium meliloti 1021] Length = 463 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validated 0.0
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide reducta 1e-157
PLN02546558 PLN02546, PLN02546, glutathione reductase 1e-118
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 1e-115
PLN02507499 PLN02507, PLN02507, glutathione reductase 1e-113
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 1e-108
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide reduc 5e-98
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 9e-86
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reductase s 3e-85
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisional 1e-83
KOG4716503 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Postt 2e-83
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 3e-79
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 2e-78
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisional 2e-75
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 5e-73
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-69
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 4e-67
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 1e-59
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 1e-57
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 4e-56
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide oxido 8e-51
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 1e-49
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validat 6e-48
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 4e-47
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide oxido 4e-41
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 8e-40
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisiona 1e-37
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; Provis 4e-35
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 2e-14
KOG0405478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 1e-127
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 3e-65
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-61
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; Provis 4e-36
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; Provis 1e-35
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 4e-51
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 2e-17
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 3e-16
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 3e-08
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homotetram 4e-06
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase beta 3e-04
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 4e-04
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 0.001
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 3e-40
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphid 6e-31
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-28
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase; Rev 8e-19
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase; Pro 3e-18
KOG1336478 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredo 4e-16
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing subuni 2e-10
KOG0404322 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Postt 2e-09
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase 2e-09
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy produc 7e-09
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], 2e-08
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Pr 1e-06
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisional 2e-04
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide ox 5e-14
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase ferred 3e-08
KOG1346659 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apo 2e-07
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide 9e-06
KOG2495491 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquino 0.002
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 2e-06
PRK07803 626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 2e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 3e-05
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydrogenase; 8e-05
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deaminati 2e-04
COG0562374 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope 2e-04
pfam01266309 pfam01266, DAO, FAD dependent oxidoreductase 3e-04
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 3e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 4e-04
TIGR00031377 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase 0.001
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 0.002
COG2509486 COG2509, COG2509, Uncharacterized FAD-dependent dehydro 1e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 1e-04
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in K+ tr 4e-04
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; Review 4e-04
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, YgfK s 0.003
>gnl|CDD|180410 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|162352 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|178161 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178123 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|130490 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|162359 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173157 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173190 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|30839 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|145812 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerization domain Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|31443 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|143852 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|36560 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|37706 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31009 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30908 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161671 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|32579 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183763 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 461 glutathione reductase [Candidatus Liberibacter asiaticu
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 100.0
PRK06116450 glutathione reductase; Validated 100.0
PTZ00052541 thioredoxin reductase; Provisional 100.0
PTZ00153673 lipoamide dehydrogenase; Provisional 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 100.0
PRK06370459 mercuric reductase; Validated 100.0
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 100.0
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07845467 flavoprotein disulfide reductase; Reviewed 100.0
PRK05976464 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 100.0
PRK07846453 mycothione/glutathione reductase; Reviewed 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 100.0
KOG1335506 consensus 100.0
KOG0405478 consensus 100.0
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 100.0
KOG4716503 consensus 100.0
PRK09564443 coenzyme A disulfide reductase; Reviewed 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase; InterP 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 100.0
KOG1336478 consensus 99.96
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.96
KOG1346659 consensus 99.87
PRK04965378 nitric oxide reductase; Provisional 100.0
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 100.0
PRK12770350 putative glutamate synthase subunit beta; Provisional 100.0
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 100.0
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 100.0
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 100.0
PRK11749460 putative oxidoreductase; Provisional 99.98
PRK12831464 putative oxidoreductase; Provisional 99.97
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK098531032 putative selenate reductase subunit YgfK; Provisional 99.97
PRK12814652 putative NADPH-dependent glutamate synthase small subun 99.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.96
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 99.96
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.96
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.96
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.95
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 99.95
PRK13984604 putative oxidoreductase; Provisional 99.95
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 99.94
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.94
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 99.93
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 99.93
KOG0404322 consensus 99.91
KOG2495491 consensus 99.9
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 99.84
KOG03992142 consensus 99.78
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 99.76
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.69
KOG2755334 consensus 99.62
KOG1399448 consensus 99.45
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 99.32
KOG3851446 consensus 99.2
KOG1800468 consensus 99.04
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 97.97
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.94
TIGR01816615 sdhA_forward succinate dehydrogenase, flavoprotein subu 97.77
TIGR01812636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 97.3
PRK05257499 malate:quinone oxidoreductase; Validated 96.95
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 96.31
PTZ00318514 NADH dehydrogenase; Provisional 99.97
pfam02852110 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreduc 99.93
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 99.59
PTZ00188506 adrenodoxin reductase; Provisional 98.99
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.46
COG4529474 Uncharacterized protein conserved in bacteria [Function 98.05
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.84
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 97.71
PRK09897535 hypothetical protein; Provisional 97.15
PRK09077535 L-aspartate oxidase; Provisional 99.45
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.39
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK08071510 L-aspartate oxidase; Provisional 99.33
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.32
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.31
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.28
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.26
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.26
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.25
PRK08275554 putative oxidoreductase; Provisional 99.24
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.24
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.23
PRK07395556 L-aspartate oxidase; Provisional 99.23
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.22
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 99.19
PRK07804533 L-aspartate oxidase; Provisional 99.18
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.17
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.16
PRK08401464 L-aspartate oxidase; Provisional 99.16
PRK06175433 L-aspartate oxidase; Provisional 99.15
PRK06854 610 adenylylsulfate reductase; Validated 99.08
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 99.06
PRK07512507 L-aspartate oxidase; Provisional 99.03
PRK12842 567 putative succinate dehydrogenase; Reviewed 99.01
PRK12843 576 putative FAD-binding dehydrogenase; Reviewed 98.99
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.99
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.96
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.93
PRK08274456 tricarballylate dehydrogenase; Validated 98.79
PRK12839 574 hypothetical protein; Provisional 98.75
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.7
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.7
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.68
PRK11445348 putative oxidoreductase; Provisional 98.66
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.63
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 98.63
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.56
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.47
PRK07121491 hypothetical protein; Validated 98.46
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.42
PRK08774402 consensus 98.41
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.4
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.35
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.32
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 98.3
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.28
KOG0029501 consensus 98.28
PRK02106555 choline dehydrogenase; Validated 98.27
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.24
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.24
PRK07208474 hypothetical protein; Provisional 98.23
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.17
PRK06185409 hypothetical protein; Provisional 98.16
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 98.14
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.13
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.12
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 98.11
KOG2311 679 consensus 98.07
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.06
PRK06126545 hypothetical protein; Provisional 98.04
KOG2415621 consensus 97.98
PRK08294 634 phenol 2-monooxygenase; Provisional 97.98
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 97.96
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.95
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.92
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 97.9
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.87
PRK06996397 hypothetical protein; Provisional 97.85
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.84
PRK06475400 salicylate hydroxylase; Provisional 97.83
KOG0042 680 consensus 97.8
PRK07045388 putative monooxygenase; Reviewed 97.79
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 97.77
PRK08132549 hypothetical protein; Provisional 97.76
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 97.74
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.73
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.73
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 97.7
PRK07538413 hypothetical protein; Provisional 97.59
KOG4254561 consensus 97.58
PRK06753373 hypothetical protein; Provisional 97.55
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.53
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.53
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.51
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.51
COG3349485 Uncharacterized conserved protein [Function unknown] 97.48
PRK05868372 hypothetical protein; Validated 97.46
PRK07236386 hypothetical protein; Provisional 97.44
PRK07608389 hypothetical protein; Provisional 97.43
COG3573552 Predicted oxidoreductase [General function prediction o 97.41
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 97.41
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.38
PRK08013400 hypothetical protein; Provisional 97.35
PRK07846453 mycothione/glutathione reductase; Reviewed 97.35
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.33
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.33
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.3
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 97.3
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.24
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.21
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.16
KOG2844 856 consensus 97.13
KOG1298509 consensus 97.07
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.02
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 97.0
PRK12416466 protoporphyrinogen oxidase; Provisional 97.0
KOG2404477 consensus 96.86
KOG0685498 consensus 96.83
KOG1238 623 consensus 96.73
pfam00996439 GDI GDP dissociation inhibitor. 96.73
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 96.68
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 96.5
KOG1335506 consensus 96.36
KOG2614420 consensus 96.23
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 96.13
KOG2853509 consensus 96.05
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 95.97
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 95.96
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 95.94
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.9
KOG2665453 consensus 95.79
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 95.72
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.7
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 95.51
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.5
KOG1276491 consensus 95.5
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.42
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.41
PRK11883452 protoporphyrinogen oxidase; Reviewed 95.36
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.21
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 95.18
PRK07588391 hypothetical protein; Provisional 95.17
PRK08163396 salicylate hydroxylase; Provisional 95.09
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.04
KOG3855481 consensus 95.02
PRK07233430 hypothetical protein; Provisional 94.97
KOG2960328 consensus 94.88
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 94.71
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.36
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 94.13
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.11
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 94.08
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 93.99
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 93.85
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.49
PRK05650270 short chain dehydrogenase; Provisional 93.36
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 93.36
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 93.27
PRK05876275 short chain dehydrogenase; Provisional 93.15
PRK08267258 short chain dehydrogenase; Provisional 92.96
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 92.9
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 92.7
PRK07660283 consensus 92.65
KOG4405547 consensus 92.61
KOG1439440 consensus 92.56
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.34
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 92.29
PRK11728400 hypothetical protein; Provisional 92.26
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.23
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 92.08
PRK09117282 consensus 92.07
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 92.02
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 91.98
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.78
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 91.76
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.75
PRK13977577 myosin-cross-reactive antigen; Provisional 91.71
PRK07102243 short chain dehydrogenase; Provisional 91.71
PRK05872296 short chain dehydrogenase; Provisional 91.69
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.61
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.61
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 91.57
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.48
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.33
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.25
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 91.15
PRK07024256 short chain dehydrogenase; Provisional 90.98
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.94
PRK12828239 short chain dehydrogenase; Provisional 90.91
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 90.88
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 90.79
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.75
PRK06841255 short chain dehydrogenase; Provisional 90.65
KOG2403 642 consensus 90.46
COG0579429 Predicted dehydrogenase [General function prediction on 90.43
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 90.29
PRK06101241 short chain dehydrogenase; Provisional 90.29
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 90.27
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 90.24
PRK08339263 short chain dehydrogenase; Provisional 90.16
PRK07041240 short chain dehydrogenase; Provisional 90.13
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.13
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.44
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.34
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.74
COG0579429 Predicted dehydrogenase [General function prediction on 98.54
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 96.69
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 93.13
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 90.46
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 99.43
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.28
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.27
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.07
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.06
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.04
PRK13984604 putative oxidoreductase; Provisional 98.03
PRK11749460 putative oxidoreductase; Provisional 98.0
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.0
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 97.93
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.92
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 97.89
PRK04965378 nitric oxide reductase; Provisional 97.86
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.86
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.84
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 97.81
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.72
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.72
PRK12831464 putative oxidoreductase; Provisional 97.71
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.61
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.58
PRK12770350 putative glutamate synthase subunit beta; Provisional 97.58
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 97.58
PRK10262321 thioredoxin reductase; Provisional 97.55
PRK09496455 trkA potassium transporter peripheral membrane componen 97.41
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.41
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.23
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 97.16
KOG1336 478 consensus 96.86
KOG03992142 consensus 96.74
KOG1399448 consensus 96.57
COG2072 443 TrkA Predicted flavoprotein involved in K+ transport [I 96.57
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 96.56
TIGR01424 478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 95.73
KOG2495 491 consensus 94.46
KOG3851 446 consensus 94.03
PRK12921306 2-dehydropantoate 2-reductase; Provisional 92.43
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 91.87
pfam03486405 HI0933_like HI0933-like protein. 91.7
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 90.97
COG2081408 Predicted flavoproteins [General function prediction on 90.67
PRK05855582 short chain dehydrogenase; Validated 90.61
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 90.16
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 99.36
pfam01134391 GIDA Glucose inhibited division protein A. 99.29
COG2081408 Predicted flavoproteins [General function prediction on 99.28
pfam03486405 HI0933_like HI0933-like protein. 99.18
PRK10157428 putative oxidoreductase FixC; Provisional 99.11
PRK10015429 hypothetical protein; Provisional 99.08
PRK06834488 hypothetical protein; Provisional 98.91
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.91
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 98.9
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 98.81
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.61
PRK06184503 hypothetical protein; Provisional 98.54
PRK07190480 hypothetical protein; Provisional 98.51
PRK08244494 hypothetical protein; Provisional 98.39
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 98.34
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 98.14
PRK06847375 hypothetical protein; Provisional 98.02
PRK13512438 coenzyme A disulfide reductase; Provisional 97.93
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.89
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.88
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.86
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.83
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.76
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.69
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.67
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.65
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.65
PRK06370459 mercuric reductase; Validated 97.64
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.64
PRK06116450 glutathione reductase; Validated 97.62
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.6
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.6
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.55
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.54
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.51
PTZ00052541 thioredoxin reductase; Provisional 97.5
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 95.05
PRK09126392 hypothetical protein; Provisional 94.24
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.0
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.86
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.06
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 90.14
PRK11259377 solA N-methyltryptophan oxidase; Provisional 98.9
PRK11728400 hypothetical protein; Provisional 98.86
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 98.85
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.85
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.81
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.76
PRK09126392 hypothetical protein; Provisional 98.75
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.74
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.72
PRK08163396 salicylate hydroxylase; Provisional 98.71
PRK07233430 hypothetical protein; Provisional 98.69
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.67
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 98.64
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.56
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.5
PRK07588391 hypothetical protein; Provisional 98.49
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.43
PRK08948392 consensus 98.38
PRK08013400 hypothetical protein; Provisional 98.37
PRK06847375 hypothetical protein; Provisional 98.28
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.27
PRK07608389 hypothetical protein; Provisional 98.24
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 98.2
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.16
PRK07045388 putative monooxygenase; Reviewed 98.16
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.05
PRK05868372 hypothetical protein; Validated 98.0
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.93
PRK07236386 hypothetical protein; Provisional 97.86
PRK06753373 hypothetical protein; Provisional 97.72
PRK11883452 protoporphyrinogen oxidase; Reviewed 97.69
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.67
PRK06475400 salicylate hydroxylase; Provisional 97.51
PRK06185409 hypothetical protein; Provisional 97.47
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 97.38
KOG2820399 consensus 97.34
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.24
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 97.19
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.1
PRK10015429 hypothetical protein; Provisional 97.08
PRK07538413 hypothetical protein; Provisional 96.89
PRK08774402 consensus 96.7
PRK06996397 hypothetical protein; Provisional 96.62
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 96.52
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 96.21
PRK07208474 hypothetical protein; Provisional 95.76
PRK06184 503 hypothetical protein; Provisional 95.38
KOG0029501 consensus 94.95
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 94.9
PRK07190 480 hypothetical protein; Provisional 94.87
KOG1346 659 consensus 94.87
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 94.61
COG2907447 Predicted NAD/FAD-binding protein [General function pre 94.41
PRK06834 488 hypothetical protein; Provisional 94.36
PRK12416466 protoporphyrinogen oxidase; Provisional 94.12
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 92.75
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 91.61
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 90.47
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.46
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 98.37
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 97.31
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 94.31
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 98.43
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.35
PRK13748 561 putative mercuric reductase; Provisional 98.02
PTZ00318 514 NADH dehydrogenase; Provisional 97.21
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.9
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 95.34
KOG1298 509 consensus 95.23
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 94.8
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 94.15
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 93.61
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 93.4
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 93.0
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.39
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 90.75
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 90.69
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 90.08
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 90.03
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 90.02
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 97.95
PRK06126545 hypothetical protein; Provisional 97.4
PRK08132549 hypothetical protein; Provisional 97.38
PRK08274456 tricarballylate dehydrogenase; Validated 95.15
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 93.12
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 97.38
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 97.38
PRK08244494 hypothetical protein; Provisional 97.32
pfam01134391 GIDA Glucose inhibited division protein A. 97.19
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 95.73
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 95.66
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 95.14
KOG2311 679 consensus 94.91
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 94.88
KOG2614420 consensus 94.81
PRK06481506 fumarate reductase flavoprotein subunit; Validated 94.43
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.43
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 92.95
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 92.62
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 92.16
PRK11445348 putative oxidoreductase; Provisional 91.05
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 90.56
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 96.83
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.94
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 90.19
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 96.75
PTZ00153 673 lipoamide dehydrogenase; Provisional 96.67
PTZ00188506 adrenodoxin reductase; Provisional 95.42
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 91.42
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 90.74
PRK09897535 hypothetical protein; Provisional 96.53
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 96.23
PRK08294 634 phenol 2-monooxygenase; Provisional 95.55
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.97
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 94.38
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.0
COG3349485 Uncharacterized conserved protein [Function unknown] 92.79
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 91.83
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258 These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information