254781055

254781055

glutathione reductase

GeneID in NCBI database:8210078Locus tag:CLIBASIA_04785
Protein GI in NCBI database:254781055Protein Accession:YP_003065468.1
Gene range:+(1059788, 1061173)Protein Length:461aa
Gene description:glutathione reductase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
KEGG prediction:gor; glutathione reductase (EC:1.8.1.7); K00383 glutathione reductase (NADPH) [EC:1.8.1.7]
SEED prediction:Glutathione reductase (EC 1.8.1.7)
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Glutathione: Redox cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
ccccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccEEEEEcccEEEEEcccEEEEccccEEcccccccccccccccEEEccHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEcccEEEEccEEEEccccccccccccHHHcccEEcccccEEEccccccccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEccccHHHHHHccccEEEEEEEcccccHHHcccccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcc
ccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHccHHHHHHHHHHHHHHHHHHHcHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEccccccEEEEccEEEEcccEEEcccEEEcccccccHHHcEcHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEcccEEEEEEcccccEEEEEccccEEEEcEEEEcccEEEccHHHcHHHHcccEcccccEccccccEcccccEEEcHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEEccHHHHHccccEEEEEEEEEcccHHHccccccEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHcccEHHHHHcccccccccHHHHHccccccEEEEccEEEcc
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEyrvggtcvirgcipkkLMFYASQYSEyfedsqgfgwsvdhksfdWQSLITAQNKELSRLESFYHNRLESAGVeifaskgilssphsvYIANLNRTITSRYIVVstggspnrmdfkgsdlcitsdeifslkslpqstliigGGYIAVEFAGILnslgskttlvtrgnsilskfdsdIRQGLTDVMISrgmqvfhndTIESVVSESGQLKSIlksgkivktdqvilavgrtprttgiglekvgvkmdengfiitdcysrtnvqsifslgdisghiqltPVAIHAAACFVEtvfkdnptipdydlvptavfskpeiasvgltEEEAVQKFCRLEiyktkffpmkcflskRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKagcvkkdfdrcmavhptsseelvtmynpqylIENGIKQVL
mryeydlvvigagssgvrsARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVstggspnrmdFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRgnsilskfdsdiRQGLTDVMISRGMQVFHNDTIESVVSESGQLKsilksgkivktdqvilavgrtprttgiglekvgvkmdENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHptsseelvtmynpqYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIE*******
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
*RYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL
MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYSEYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPHSVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESGQLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQVL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 2e-49
254781053466 dihydrolipoamide dehydrogenase [Candidatus Liberib 1e-46
>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment 
 Score =  188 bits (477), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 131/469 (27%), Positives = 232/469 (49%), Gaps = 28/469 (5%)

Query: 1   MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYS 60
           M   YD+++IG+G +G  +A  AAQLG KVAI E   +GG C+  GCIP K +  +++  
Sbjct: 1   MSRLYDIILIGSGPAGYVAAIRAAQLGFKVAIVEYAGLGGICLNWGCIPTKSLLRSAEIL 60

Query: 61  EYFEDSQGFGWSVDHK-SFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSP 119
           ++ +++Q +G +V  K  F+ + ++        RL       +    V+I   K  L +P
Sbjct: 61  DHIQNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNP 120

Query: 120 HSVYIANLNR-----------------TITSRYIVVSTGGSPNRMDF--KGSDLCITSDE 160
             + ++  ++                 T  +++I+++TG  P  ++     S L  T  +
Sbjct: 121 SEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIEPDSHLIWTYFD 180

Query: 161 IFSLKSLPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMI 220
                  P+S +++G G I VEF+    SL    +L+   + IL   DS+I Q +   + 
Sbjct: 181 ALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSLQ 240

Query: 221 SRGMQVFHNDTIESVVSESGQLKSI---LKSGKI--VKTDQVILAVGRTPRTTGIGLEKV 275
            RG+++     I S V + G + S+    K G +  ++ ++++L+ G       IGLEK+
Sbjct: 241 KRGIKILTESKISS-VKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKI 299

Query: 276 GVKMDENGFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAAACFVETVFKDNPTIP-D 334
           GVK   NG II D Y RTNV  I+++GD++G   L   A H     +E +   +   P D
Sbjct: 300 GVKTS-NGCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLD 358

Query: 335 YDLVPTAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHA 394
              +P   +  P++AS+GLTEE+A  +   + + K  F      ++   +  ++K I + 
Sbjct: 359 KSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNN 418

Query: 395 DNHKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443
              +VLGVH++G E +E+IQ   + +     +++    +  HPT SE +
Sbjct: 419 KTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETM 467
>gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Back     alignment 
 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 137/467 (29%), Positives = 230/467 (49%), Gaps = 45/467 (9%)

Query: 5   YDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRV-GGTCVIRGCIPKKLMFYASQ-YSEY 62
           YD+ V+G G +G   A  AAQL  KVAI E+ +  GGTC+  GCIP K + +AS+ YS  
Sbjct: 3   YDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHI 62

Query: 63  FEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPH-S 121
            +++   G ++     D + +++ +    S +ES       + G+     K  + + H S
Sbjct: 63  AKEAGDLGINIASCHLDLKKMMSYKK---SIVES------NTQGINFLLKKNKIITYHGS 113

Query: 122 VYIANLNR----------TITSRYIVVSTG----GSPN-RMDFKGSDLCITSDEIFSLKS 166
             I + N+          TI ++ IV++TG    G P   +DF    + ++S    S  S
Sbjct: 114 ARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFD-EQVIVSSTGALSFSS 172

Query: 167 LPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQV 226
           +P++ L+IG G I +E   +   LGS   ++    +IL+  D +I      +M  +GM  
Sbjct: 173 VPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNF 232

Query: 227 FHNDTIESVVSESGQLKSILKSGK----IVKTDQVILAVGRTPRTTGIGLEKVGVKMDEN 282
             N  + SV    G+ + + +S       ++ D V++A GR P T G+GLE++G+ +D  
Sbjct: 233 QLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHR 292

Query: 283 GFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAA---ACFVETVFKDNPTIPDYDLVP 339
           G I      +T++ +I+++GD+       P+  H A      V  +        +Y ++P
Sbjct: 293 GCIEIGGQFQTSISTIYAIGDVV----RGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIP 348

Query: 340 TAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTI---MKIIVHADN 396
           + V++ PE+AS+G TEE   Q  C  + YK   FP       R  ++I   +KI+ +  +
Sbjct: 349 SVVYTHPEVASIGKTEE---QLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKS 405

Query: 397 HKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443
            +V GVHI+G  A E+I    V ++ G   +D  R    HPT SE +
Sbjct: 406 DRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAV 452

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
315122393461 glutathione reductase [Candidatus Liberibacter solanace 1 0.0
222148538462 glutathione reductase [Agrobacterium vitis S4] Length = 1 1e-152
222086213461 glutathione-disulfide reductase [Agrobacterium radiobac 1 1e-151
190892055461 glutathione reductase [Rhizobium etli CIAT 652] Length 1 1e-150
152980459462 glutathione reductase [Janthinobacterium sp. Marseille] 1 1e-150
86357992461 glutathione reductase [Rhizobium etli CFN 42] Length = 1 1e-149
325293001462 glutathione reductase [Agrobacterium sp. H13-3] Length 1 1e-149
163759647462 glutathione reductase [Hoeflea phototrophica DFL-43] Le 1 1e-146
209549602461 glutathione reductase [Rhizobium leguminosarum bv. trif 1 1e-145
15965607463 glutathione reductase [Sinorhizobium meliloti 1021] Len 1 1e-145
>gi|315122393|ref|YP_004062882.1| glutathione reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 461 Back     alignment and organism information
 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/459 (78%), Positives = 418/459 (91%)

Query: 1   MRYEYDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCIPKKLMFYASQYS 60
           M YEYDL+VIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGC+PKKLMFYASQYS
Sbjct: 1   MLYEYDLIVIGAGSSGVRSARLAAQLGKKVAICEEYRVGGTCVIRGCVPKKLMFYASQYS 60

Query: 61  EYFEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPH 120
           ++FEDS+GFGWSV ++SFDW SLI  Q+KELSRLESFYH+RL+SAGVEI  S+ ILSSPH
Sbjct: 61  DHFEDSKGFGWSVGYQSFDWPSLIAEQDKELSRLESFYHDRLDSAGVEILKSRAILSSPH 120

Query: 121 SVYIANLNRTITSRYIVVSTGGSPNRMDFKGSDLCITSDEIFSLKSLPQSTLIIGGGYIA 180
            VY+AN++RTIT++YIVV+TGGSP+RMDF+G +LCITS+E+FSL+SLPQS LI+GGGYIA
Sbjct: 121 EVYLANVDRTITAQYIVVATGGSPDRMDFEGCNLCITSEEVFSLESLPQSILIVGGGYIA 180

Query: 181 VEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQVFHNDTIESVVSESG 240
           VEFA I N+LGSKTTLVTRGNSILS+FD D+RQGLT++M S+G+++  N+T +SV SESG
Sbjct: 181 VEFACIFNALGSKTTLVTRGNSILSRFDVDMRQGLTEIMNSKGIRIISNNTPKSVFSESG 240

Query: 241 QLKSILKSGKIVKTDQVILAVGRTPRTTGIGLEKVGVKMDENGFIITDCYSRTNVQSIFS 300
            LKSIL+S +I+ TDQV+LAVGR PRT  IGL+K+GV MD NGFI+TD YSRTN+ SIF+
Sbjct: 241 HLKSILESEEIIMTDQVMLAVGRKPRTMDIGLDKLGVAMDANGFIVTDRYSRTNIDSIFA 300

Query: 301 LGDISGHIQLTPVAIHAAACFVETVFKDNPTIPDYDLVPTAVFSKPEIASVGLTEEEAVQ 360
            GDISG  QLTPVAIHAAACFVETVFKDNPT PDYDL+PTAVFS+PEI+SVGLTEEEA  
Sbjct: 301 FGDISGQAQLTPVAIHAAACFVETVFKDNPTSPDYDLIPTAVFSQPEISSVGLTEEEATH 360

Query: 361 KFCRLEIYKTKFFPMKCFLSKRFEHTIMKIIVHADNHKVLGVHILGHEASEIIQVLGVCL 420
           +F RLEIYKTKFFP+K FLSKRFEHTIMKIIV+ADN KVLGVHILG E+SEIIQVLG+CL
Sbjct: 361 QFPRLEIYKTKFFPIKSFLSKRFEHTIMKIIVNADNRKVLGVHILGSESSEIIQVLGICL 420

Query: 421 KAGCVKKDFDRCMAVHPTSSEELVTMYNPQYLIENGIKQ 459
           K+GCVK+DFDRCMAVHPT++EELVTMY+P YLIE GIK+
Sbjct: 421 KSGCVKEDFDRCMAVHPTATEELVTMYHPSYLIEEGIKK 459



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148538|ref|YP_002549495.1| glutathione reductase [Agrobacterium vitis S4] Length = 462 Back     alignment and organism information
>gi|222086213|ref|YP_002544745.1| glutathione-disulfide reductase [Agrobacterium radiobacter K84] Length = 461 Back     alignment and organism information
>gi|190892055|ref|YP_001978597.1| glutathione reductase [Rhizobium etli CIAT 652] Length = 461 Back     alignment and organism information
>gi|152980459|ref|YP_001352656.1| glutathione reductase [Janthinobacterium sp. Marseille] Length = 462 Back     alignment and organism information
>gi|86357992|ref|YP_469884.1| glutathione reductase [Rhizobium etli CFN 42] Length = 461 Back     alignment and organism information
>gi|325293001|ref|YP_004278865.1| glutathione reductase [Agrobacterium sp. H13-3] Length = 462 Back     alignment and organism information
>gi|163759647|ref|ZP_02166732.1| glutathione reductase [Hoeflea phototrophica DFL-43] Length = 462 Back     alignment and organism information
>gi|209549602|ref|YP_002281519.1| glutathione reductase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 461 Back     alignment and organism information
>gi|15965607|ref|NP_385960.1| glutathione reductase [Sinorhizobium meliloti 1021] Length = 463 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target461 glutathione reductase [Candidatus Liberibacter asiaticu
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validated 0.0
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide reducta 1e-157
PLN02546558 PLN02546, PLN02546, glutathione reductase 1e-118
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 1e-115
PLN02507499 PLN02507, PLN02507, glutathione reductase 1e-113
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 1e-108
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide reduc 5e-98
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 9e-86
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reductase s 3e-85
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisional 1e-83
KOG4716503 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Postt 2e-83
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 3e-79
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 2e-78
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisional 2e-75
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 5e-73
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-69
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 4e-67
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 1e-59
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 1e-57
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 4e-56
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide oxido 8e-51
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 1e-49
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validat 6e-48
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 4e-47
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide oxido 4e-41
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 8e-40
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisiona 1e-37
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; Provis 4e-35
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 2e-14
KOG0405478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 1e-127
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 3e-65
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 3e-61
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; Provis 4e-36
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; Provis 1e-35
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 4e-51
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 2e-17
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 3e-16
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 3e-08
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homotetram 4e-06
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase beta 3e-04
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 4e-04
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 0.001
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 3e-40
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphid 6e-31
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-28
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase; Rev 8e-19
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase; Pro 3e-18
KOG1336478 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredo 4e-16
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing subuni 2e-10
KOG0404322 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Postt 2e-09
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase 2e-09
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy produc 7e-09
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], 2e-08
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Pr 1e-06
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisional 2e-04
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide ox 5e-14
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase ferred 3e-08
KOG1346659 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apo 2e-07
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide 9e-06
KOG2495491 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquino 0.002
PRK12843 578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 2e-06
PRK07803 626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 2e-05
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 3e-05
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydrogenase; 8e-05
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deaminati 2e-04
COG0562374 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope 2e-04
pfam01266309 pfam01266, DAO, FAD dependent oxidoreductase 3e-04
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 3e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 4e-04
TIGR00031377 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase 0.001
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 0.002
COG2509486 COG2509, COG2509, Uncharacterized FAD-dependent dehydro 1e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 1e-04
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in K+ tr 4e-04
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; Review 4e-04
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, YgfK s 0.003
>gnl|CDD|180410 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|162352 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|178161 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178123 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|130490 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|162359 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173157 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173190 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|30839 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|145812 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerization domain Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|31443 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|143852 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|36560 KOG1346, KOG1346, KOG1346, Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|37706 KOG2495, KOG2495, KOG2495, NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31009 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30908 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161671 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|32579 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183763 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 461 glutathione reductase [Candidatus Liberibacter asiaticu
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 100.0
PRK06116450 glutathione reductase; Validated 100.0
PTZ00052541 thioredoxin reductase; Provisional 100.0
PTZ00153673 lipoamide dehydrogenase; Provisional 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 100.0
PRK06370459 mercuric reductase; Validated 100.0
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 100.0
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK07845467 flavoprotein disulfide reductase; Reviewed 100.0
PRK05976464 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 100.0
PRK07846453 mycothione/glutathione reductase; Reviewed 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 100.0
KOG1335506 consensus 100.0
KOG0405478 consensus 100.0
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 100.0
KOG4716503 consensus 100.0
PRK09564443 coenzyme A disulfide reductase; Reviewed 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase; InterP 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 100.0
KOG1336478 consensus 99.96
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.96
KOG1346659 consensus 99.87
PRK04965378 nitric oxide reductase; Provisional 100.0
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 100.0
PRK12770350 putative glutamate synthase subunit beta; Provisional 100.0
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 100.0
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 100.0
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 100.0
PRK11749460 putative oxidoreductase; Provisional 99.98
PRK12831464 putative oxidoreductase; Provisional 99.97
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK098531032 putative selenate reductase subunit YgfK; Provisional 99.97
PRK12814652 putative NADPH-dependent glutamate synthase small subun 99.96
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.96
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 99.96
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.96
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.96
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.95
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 99.95
PRK13984604 putative oxidoreductase; Provisional 99.95
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 99.94
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.94
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 99.93
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 99.93
KOG0404322 consensus 99.91
KOG2495491 consensus 99.9
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 99.84
KOG03992142 consensus 99.78
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 99.76
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.69
KOG2755334 consensus 99.62
KOG1399448 consensus 99.45
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 99.32
KOG3851446 consensus 99.2
KOG1800468 consensus 99.04
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 97.97
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.94
TIGR01816615 sdhA_forward succinate dehydrogenase, flavoprotein subu 97.77
TIGR01812636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 97.3
PRK05257499 malate:quinone oxidoreductase; Validated 96.95
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 96.31
PTZ00318514 NADH dehydrogenase; Provisional 99.97
pfam02852110 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreduc 99.93
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 99.59
PTZ00188506 adrenodoxin reductase; Provisional 98.99
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.46
COG4529474 Uncharacterized protein conserved in bacteria [Function 98.05
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.84
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 97.71
PRK09897535 hypothetical protein; Provisional 97.15
PRK09077535 L-aspartate oxidase; Provisional 99.45
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.39
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.34
PRK08071510 L-aspartate oxidase; Provisional 99.33
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.32
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.31
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.28
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.26
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.26
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.25
PRK08275554 putative oxidoreductase; Provisional 99.24
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.24
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.23
PRK07395556 L-aspartate oxidase; Provisional 99.23
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.22
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 99.19
PRK07804533 L-aspartate oxidase; Provisional 99.18
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.17
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.16
PRK08401464 L-aspartate oxidase; Provisional 99.16
PRK06175433 L-aspartate oxidase; Provisional 99.15
PRK06854 610 adenylylsulfate reductase; Validated 99.08
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 99.06
PRK07512507 L-aspartate oxidase; Provisional 99.03
PRK12842 567 putative succinate dehydrogenase; Reviewed 99.01
PRK12843 576 putative FAD-binding dehydrogenase; Reviewed 98.99
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.99
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.96
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.93
PRK08274456 tricarballylate dehydrogenase; Validated 98.79
PRK12839 574 hypothetical protein; Provisional 98.75
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.7
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.7
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.68
PRK11445348 putative oxidoreductase; Provisional 98.66
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.63
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 98.63
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.56
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.47
PRK07121491 hypothetical protein; Validated 98.46
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.42
PRK08774402 consensus 98.41
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.4
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.35
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.32
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 98.3
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.28
KOG0029501 consensus 98.28
PRK02106555 choline dehydrogenase; Validated 98.27
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.24
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.24
PRK07208474 hypothetical protein; Provisional 98.23
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.17
PRK06185409 hypothetical protein; Provisional 98.16
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 98.14
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.13
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.12
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 98.11
KOG2311 679 consensus 98.07
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.06
PRK06126545 hypothetical protein; Provisional 98.04
KOG2415621 consensus 97.98
PRK08294 634 phenol 2-monooxygenase; Provisional 97.98
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 97.96
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.95
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.92
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 97.9
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.87
PRK06996397 hypothetical protein; Provisional 97.85
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 97.84
PRK06475400 salicylate hydroxylase; Provisional 97.83
KOG0042 680 consensus 97.8
PRK07045388 putative monooxygenase; Reviewed 97.79
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 97.77
PRK08132549 hypothetical protein; Provisional 97.76
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 97.74
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.73
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.73
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 97.7
PRK07538413 hypothetical protein; Provisional 97.59
KOG4254561 consensus 97.58
PRK06753373 hypothetical protein; Provisional 97.55
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.53
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.53
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.51
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.51
COG3349485 Uncharacterized conserved protein [Function unknown] 97.48
PRK05868372 hypothetical protein; Validated 97.46
PRK07236386 hypothetical protein; Provisional 97.44
PRK07608389 hypothetical protein; Provisional 97.43
COG3573552 Predicted oxidoreductase [General function prediction o 97.41
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 97.41
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.38
PRK08013400 hypothetical protein; Provisional 97.35
PRK07846453 mycothione/glutathione reductase; Reviewed 97.35
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.33
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.33
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.3
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 97.3
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.24
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.21
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.16
KOG2844 856 consensus 97.13
KOG1298509 consensus 97.07
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.02
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 97.0
PRK12416466 protoporphyrinogen oxidase; Provisional 97.0
KOG2404477 consensus 96.86
KOG0685498 consensus 96.83
KOG1238 623 consensus 96.73
pfam00996439 GDI GDP dissociation inhibitor. 96.73
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 96.68
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 96.5
KOG1335506 consensus 96.36
KOG2614420 consensus 96.23
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 96.13
KOG2853509 consensus 96.05
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 95.97
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 95.96
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 95.94
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.9
KOG2665453 consensus 95.79
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 95.72
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.7
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 95.51
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.5
KOG1276491 consensus 95.5
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.42
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.41
PRK11883452 protoporphyrinogen oxidase; Reviewed 95.36
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.21
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 95.18
PRK07588391 hypothetical protein; Provisional 95.17
PRK08163396 salicylate hydroxylase; Provisional 95.09
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.04
KOG3855481 consensus 95.02
PRK07233430 hypothetical protein; Provisional 94.97
KOG2960328 consensus 94.88
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 94.71
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.36
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 94.13
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.11
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 94.08
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 93.99
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 93.85
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.49
PRK05650270 short chain dehydrogenase; Provisional 93.36
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 93.36
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 93.27
PRK05876275 short chain dehydrogenase; Provisional 93.15
PRK08267258 short chain dehydrogenase; Provisional 92.96
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 92.9
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 92.7
PRK07660283 consensus 92.65
KOG4405547 consensus 92.61
KOG1439440 consensus 92.56
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.34
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 92.29
PRK11728400 hypothetical protein; Provisional 92.26
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.23
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 92.08
PRK09117282 consensus 92.07
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 92.02
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 91.98
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.78
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 91.76
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.75
PRK13977577 myosin-cross-reactive antigen; Provisional 91.71
PRK07102243 short chain dehydrogenase; Provisional 91.71
PRK05872296 short chain dehydrogenase; Provisional 91.69
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.61
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.61
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 91.57
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.48
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.33
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.25
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.2
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 91.15
PRK07024256 short chain dehydrogenase; Provisional 90.98
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.94
PRK12828239 short chain dehydrogenase; Provisional 90.91
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 90.88
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 90.79
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.75
PRK06841255 short chain dehydrogenase; Provisional 90.65
KOG2403 642 consensus 90.46
COG0579429 Predicted dehydrogenase [General function prediction on 90.43
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 90.29
PRK06101241 short chain dehydrogenase; Provisional 90.29
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 90.27
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 90.24
PRK08339263 short chain dehydrogenase; Provisional 90.16
PRK07041240 short chain dehydrogenase; Provisional 90.13
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.13
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.44
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.34
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.74
COG0579429 Predicted dehydrogenase [General function prediction on 98.54
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 96.69
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 93.13
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 90.46
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 99.43
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.28
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.27
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.07
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 98.06
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.04
PRK13984604 putative oxidoreductase; Provisional 98.03
PRK11749460 putative oxidoreductase; Provisional 98.0
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.0
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 97.93
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.92
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 97.89
PRK04965378 nitric oxide reductase; Provisional 97.86
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.86
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.84
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 97.81
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.72
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.72
PRK12831464 putative oxidoreductase; Provisional 97.71
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.61
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.58
PRK12770350 putative glutamate synthase subunit beta; Provisional 97.58
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 97.58
PRK10262321 thioredoxin reductase; Provisional 97.55
PRK09496455 trkA potassium transporter peripheral membrane componen 97.41
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.41
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.23
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 97.16
KOG1336 478 consensus 96.86
KOG03992142 consensus 96.74
KOG1399448 consensus 96.57
COG2072 443 TrkA Predicted flavoprotein involved in K+ transport [I 96.57
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 96.56
TIGR01424 478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 95.73
KOG2495 491 consensus 94.46
KOG3851 446 consensus 94.03
PRK12921306 2-dehydropantoate 2-reductase; Provisional 92.43
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 91.87
pfam03486405 HI0933_like HI0933-like protein. 91.7
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 90.97
COG2081408 Predicted flavoproteins [General function prediction on 90.67
PRK05855582 short chain dehydrogenase; Validated 90.61
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 90.16
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 99.36
pfam01134391 GIDA Glucose inhibited division protein A. 99.29
COG2081408 Predicted flavoproteins [General function prediction on 99.28
pfam03486405 HI0933_like HI0933-like protein. 99.18
PRK10157428 putative oxidoreductase FixC; Provisional 99.11
PRK10015429 hypothetical protein; Provisional 99.08
PRK06834488 hypothetical protein; Provisional 98.91
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.91
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 98.9
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 98.81
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.61
PRK06184503 hypothetical protein; Provisional 98.54
PRK07190480 hypothetical protein; Provisional 98.51
PRK08244494 hypothetical protein; Provisional 98.39
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 98.34
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 98.14
PRK06847375 hypothetical protein; Provisional 98.02
PRK13512438 coenzyme A disulfide reductase; Provisional 97.93
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.89
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.88
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.86
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.83
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.76
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.69
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.67
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.65
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.65
PRK06370459 mercuric reductase; Validated 97.64
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.64
PRK06116450 glutathione reductase; Validated 97.62
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.6
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.6
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.55
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.54
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.51
PTZ00052541 thioredoxin reductase; Provisional 97.5
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 95.05
PRK09126392 hypothetical protein; Provisional 94.24
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.0
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.86
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 93.06
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 90.14
PRK11259377 solA N-methyltryptophan oxidase; Provisional 98.9
PRK11728400 hypothetical protein; Provisional 98.86
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 98.85
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.85
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.81
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.76
PRK09126392 hypothetical protein; Provisional 98.75
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.74
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.72
PRK08163396 salicylate hydroxylase; Provisional 98.71
PRK07233430 hypothetical protein; Provisional 98.69
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.67
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 98.64
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.56
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.5
PRK07588391 hypothetical protein; Provisional 98.49
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.43
PRK08948392 consensus 98.38
PRK08013400 hypothetical protein; Provisional 98.37
PRK06847375 hypothetical protein; Provisional 98.28
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.27
PRK07608389 hypothetical protein; Provisional 98.24
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 98.2
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.16
PRK07045388 putative monooxygenase; Reviewed 98.16
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.05
PRK05868372 hypothetical protein; Validated 98.0
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 97.93
PRK07236386 hypothetical protein; Provisional 97.86
PRK06753373 hypothetical protein; Provisional 97.72
PRK11883452 protoporphyrinogen oxidase; Reviewed 97.69
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.67
PRK06475400 salicylate hydroxylase; Provisional 97.51
PRK06185409 hypothetical protein; Provisional 97.47
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 97.38
KOG2820399 consensus 97.34
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.24
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 97.19
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.1
PRK10015429 hypothetical protein; Provisional 97.08
PRK07538413 hypothetical protein; Provisional 96.89
PRK08774402 consensus 96.7
PRK06996397 hypothetical protein; Provisional 96.62
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 96.52
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 96.21
PRK07208474 hypothetical protein; Provisional 95.76
PRK06184 503 hypothetical protein; Provisional 95.38
KOG0029501 consensus 94.95
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 94.9
PRK07190 480 hypothetical protein; Provisional 94.87
KOG1346 659 consensus 94.87
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 94.61
COG2907447 Predicted NAD/FAD-binding protein [General function pre 94.41
PRK06834 488 hypothetical protein; Provisional 94.36
PRK12416466 protoporphyrinogen oxidase; Provisional 94.12
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 92.75
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 91.61
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 90.47
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.46
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 98.37
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 97.31
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 94.31
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 98.43
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.35
PRK13748 561 putative mercuric reductase; Provisional 98.02
PTZ00318 514 NADH dehydrogenase; Provisional 97.21
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 95.9
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 95.34
KOG1298 509 consensus 95.23
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 94.8
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 94.15
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 93.61
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 93.4
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 93.0
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.39
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 90.75
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 90.69
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 90.08
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 90.03
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 90.02
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 97.95
PRK06126545 hypothetical protein; Provisional 97.4
PRK08132549 hypothetical protein; Provisional 97.38
PRK08274456 tricarballylate dehydrogenase; Validated 95.15
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 93.12
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 97.38
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 97.38
PRK08244494 hypothetical protein; Provisional 97.32
pfam01134391 GIDA Glucose inhibited division protein A. 97.19
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 95.73
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 95.66
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 95.14
KOG2311 679 consensus 94.91
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 94.88
KOG2614420 consensus 94.81
PRK06481506 fumarate reductase flavoprotein subunit; Validated 94.43
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.43
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 92.95
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 92.62
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 92.16
PRK11445348 putative oxidoreductase; Provisional 91.05
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 90.56
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 96.83
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.94
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 90.19
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 96.75
PTZ00153 673 lipoamide dehydrogenase; Provisional 96.67
PTZ00188506 adrenodoxin reductase; Provisional 95.42
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 91.42
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 90.74
PRK09897535 hypothetical protein; Provisional 96.53
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 96.23
PRK08294 634 phenol 2-monooxygenase; Provisional 95.55
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.97
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 94.38
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.0
COG3349485 Uncharacterized conserved protein [Function unknown] 92.79
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 91.83
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: IPR006258 These sequences represent dihydrolipoamide dehydrogenase, a flavoprotein that acts in a number of ways Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information