254781061

254781061

putative iron-sulfur cluster assembly protein

GeneID in NCBI database:8210084Locus tag:CLIBASIA_04815
Protein GI in NCBI database:254781061Protein Accession:YP_003065474.1
Gene range:+(1064990, 1066276)Protein Length:428aa
Gene description:putative iron-sulfur cluster assembly protein
COG prediction:[O] ABC-type transport system involved in Fe-S cluster assembly, permease component
KEGG prediction:putative iron-sulfur cluster assembly protein; K09015 Fe-S cluster assembly protein SufD
SEED prediction:Iron-sulfur cluster assembly protein SufD
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV
cccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccccccccccccEEEEEEEccccccHHHcccEEEEcccHHHHHHHHccccccccccHHHHHHHHHHcccEEEEEcccccccccEEEEEEEccccccEEEEEEEccccEEEEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEEEccEEEEEEEEEEEEccccEEEEEEEEEccccEEEEEccEEEEEccccEEEEEEEEEEccccEEEEEEEEEEcccccccccEEEccEEEEccccEEEccEEEEEEccccEEEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEc
cccccHHHccccHHHcccccHHHHHHHHHHHcHHcHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHcccccEEEEEEEEccHHHHHHHccEEcccHHHHHHcHHHHHHHHccccccccccHHHHHcccEcccccEEEEcccccccccHEHEEEccccccEEEEEEEEEcccEEEEEEcccccccccccccEEEEEEEccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEccccEEEEcccEEEEEccccccEEEEEEEEccccccccccHEEEcccccccEEEEcEEcccccccEEEEEEEEcccccccccccEccEEEEccccccccccEEEEEcccEEEEEEEEEccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccEEEc
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDfrtqgllptrkienWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQlsisqqpsssilkeknievlpfshientdensycleplsehdtigyingilsndgykvvipdecqlnvplelQAIQcggqmhlrypisfgmnsrTTVVERYTtltndnsfvssiadikvgegadITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGqglsrrelsidvkgeeSQFMLRGINLlsgkahsdlsmflrhkvpntcstSVIRNIVLEkstgvfqgavhvsseaqgsnarmTANTLLfsnegsfyvkpeleifaddvqcghgatisdinpEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNnsanmvmv
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFrtqgllptrkienwhyTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSIsqqpsssilKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTtltndnsfvsSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNigqglsrrelsidVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVsseaqgsnaRMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILsswlknnsanmvmv
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADsiqlsisqqpsssilKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV
*****AV*TMLLQSC**************AFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNN*A*M***
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV
********TMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLP*RKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNN****V**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV
MGNLTAVETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNSANMVMV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target428 putative iron-sulfur cluster assembly protein [Candidat
254781059489 cysteine desulfurase activator complex subunit Suf 2e-11
>gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62] Length = 489 Back     alignment
 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 3/174 (1%)

Query: 238 KSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCS 297
           +S +    L  G  ++ +  S  ++GE+S      I + +G    D    + H   NT S
Sbjct: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364

Query: 298 TSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQ 357
             V + I    S   ++G V V   A  S      ++LL  N    +  P +E       
Sbjct: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424

Query: 358 CGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIE 411
             H AT S I+ EHL+Y + RGI +  A +++ + F+ E+++ L    ++F++E
Sbjct: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLP---MEFAVE 475

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target428 putative iron-sulfur cluster assembly protein [Candidat
315122397290 putative iron-sulfur cluster assembly protein [Candidat 1 1e-128
241204824424 FeS assembly protein SufD [Rhizobium leguminosarum bv. 1 1e-113
116252325442 iron-sulfur cluster assembly protein [Rhizobium legumin 1 1e-112
86357865424 ABC transporter involved in Fe-S cluster assembly, perm 1 1e-112
190891949424 ABC transporter involved in Fe-S cluster assembly, perm 1 1e-112
327191055424 ABC transporter involved in Fe-S cluster assembly, perm 1 1e-110
209549491424 FeS assembly protein SufD [Rhizobium leguminosarum bv. 1 1e-110
222086101424 FeS assembly protein SufD [Agrobacterium radiobacter K8 1 1e-107
325293224423 iron-sulfur cluster assembly protein [Agrobacterium sp. 1 1e-97
227822093425 ABC transporter involved in Fe-S cluster assembly, perm 1 1e-97
>gi|315122397|ref|YP_004062886.1| putative iron-sulfur cluster assembly protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 290 Back     alignment and organism information
 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/281 (76%), Positives = 253/281 (90%)

Query: 142 DGYKVVIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSS 201
           DGYKVVIPDECQL+VPLELQ++Q G Q HLRYPISFG+NS+ T++ERYT+LTN  S VSS
Sbjct: 4   DGYKVVIPDECQLDVPLELQSVQRGEQRHLRYPISFGVNSKATIIERYTSLTNQPSLVSS 63

Query: 202 IADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDV 261
           IADIKVG+GADITW+IVLDQ +EDTHLGQLRV+LE+ + LKVF +N+GQGLSRRELSIDV
Sbjct: 64  IADIKVGKGADITWIIVLDQDVEDTHLGQLRVVLEQNALLKVFFINMGQGLSRRELSIDV 123

Query: 262 KGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSS 321
           +GEES+FMLRGINLL G+ H DLSMFLRHKVPNT STS++R+IVLEKSTG+FQGAV VS 
Sbjct: 124 EGEESRFMLRGINLLKGQTHGDLSMFLRHKVPNTSSTSIVRSIVLEKSTGIFQGAVCVSP 183

Query: 322 EAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGIS 381
           E+QGSNA M +NTLLFSNEG+F+VKPELEIFADDVQCGHGAT+S+IN +HLYYLM R I 
Sbjct: 184 ESQGSNATMASNTLLFSNEGNFFVKPELEIFADDVQCGHGATVSNINQDHLYYLMTRNIP 243

Query: 382 KNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNS 422
           KN+A SMLSHAF+SE++ DLND+VLQ SIE++LSSW+  N+
Sbjct: 244 KNEAYSMLSHAFISEVISDLNDEVLQISIEKLLSSWMDKNN 284


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204824|ref|YP_002975920.1| FeS assembly protein SufD [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 424 Back     alignment and organism information
>gi|116252325|ref|YP_768163.1| iron-sulfur cluster assembly protein [Rhizobium leguminosarum bv. viciae 3841] Length = 442 Back     alignment and organism information
>gi|86357865|ref|YP_469757.1| ABC transporter involved in Fe-S cluster assembly, permease protein [Rhizobium etli CFN 42] Length = 424 Back     alignment and organism information
>gi|190891949|ref|YP_001978491.1| ABC transporter involved in Fe-S cluster assembly, permease [Rhizobium etli CIAT 652] Length = 424 Back     alignment and organism information
>gi|327191055|gb|EGE58108.1| ABC transporter involved in Fe-S cluster assembly, permease protein [Rhizobium etli CNPAF512] Length = 424 Back     alignment and organism information
>gi|209549491|ref|YP_002281408.1| FeS assembly protein SufD [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 424 Back     alignment and organism information
>gi|222086101|ref|YP_002544633.1| FeS assembly protein SufD [Agrobacterium radiobacter K84] Length = 424 Back     alignment and organism information
>gi|325293224|ref|YP_004279088.1| iron-sulfur cluster assembly protein [Agrobacterium sp. H13-3] Length = 423 Back     alignment and organism information
>gi|227822093|ref|YP_002826064.1| ABC transporter involved in Fe-S cluster assembly, permease protein [Sinorhizobium fredii NGR234] Length = 425 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target428 putative iron-sulfur cluster assembly protein [Candidat
TIGR01981366 TIGR01981, sufD, FeS assembly protein SufD, group 1 2e-69
PRK10948424 PRK10948, PRK10948, cysteine desulfurase activator comp 1e-35
COG0719412 COG0719, SufB, ABC-type transport system involved in Fe 4e-62
pfam01458230 pfam01458, UPF0051, Uncharacterized protein family (UPF 3e-53
TIGR01980448 TIGR01980, sufB, FeS assembly protein SufB 1e-21
PRK11814486 PRK11814, PRK11814, cysteine desulfurase activator comp 1e-07
CHL00085485 CHL00085, ycf24, putative ABC transporter 6e-06
>gnl|CDD|162637 TIGR01981, sufD, FeS assembly protein SufD, group 1 Back     alignment and domain information
>gnl|CDD|182859 PRK10948, PRK10948, cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information
>gnl|CDD|31063 COG0719, SufB, ABC-type transport system involved in Fe-S cluster assembly, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144885 pfam01458, UPF0051, Uncharacterized protein family (UPF0051) Back     alignment and domain information
>gnl|CDD|131035 TIGR01980, sufB, FeS assembly protein SufB Back     alignment and domain information
>gnl|CDD|183322 PRK11814, PRK11814, cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>gnl|CDD|177024 CHL00085, ycf24, putative ABC transporter Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 428 putative iron-sulfur cluster assembly protein [Candidat
PRK10948424 cysteine desulfurase activator complex subunit SufD; Pr 100.0
CHL00085485 ycf24 putative ABC transporter 100.0
PRK11814484 cysteine desulfurase activator complex subunit SufB; Pr 100.0
COG0719412 SufB Cysteine desulfurase activator SufB [Posttranslati 100.0
TIGR01980469 sufB FeS assembly protein SufB; InterPro: IPR010231 Iro 100.0
TIGR01981397 sufD FeS assembly protein SufD; InterPro: IPR011542 Iro 100.0
pfam01458230 UPF0051 Uncharacterized protein family (UPF0051). 100.0
pfam01458230 UPF0051 Uncharacterized protein family (UPF0051). 98.54
TIGR01981397 sufD FeS assembly protein SufD; InterPro: IPR011542 Iro 98.32
COG0719412 SufB Cysteine desulfurase activator SufB [Posttranslati 97.86
PRK10948424 cysteine desulfurase activator complex subunit SufD; Pr 98.01
PRK11814484 cysteine desulfurase activator complex subunit SufB; Pr 97.22
CHL00085485 ycf24 putative ABC transporter 97.38
>PRK10948 cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information
>CHL00085 ycf24 putative ABC transporter Back     alignment and domain information
>PRK11814 cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>COG0719 SufB Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01980 sufB FeS assembly protein SufB; InterPro: IPR010231 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR01981 sufD FeS assembly protein SufD; InterPro: IPR011542 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>pfam01458 UPF0051 Uncharacterized protein family (UPF0051) Back     alignment and domain information
>pfam01458 UPF0051 Uncharacterized protein family (UPF0051) Back     alignment and domain information
>TIGR01981 sufD FeS assembly protein SufD; InterPro: IPR011542 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>COG0719 SufB Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10948 cysteine desulfurase activator complex subunit SufD; Provisional Back     alignment and domain information
>PRK11814 cysteine desulfurase activator complex subunit SufB; Provisional Back     alignment and domain information
>CHL00085 ycf24 putative ABC transporter Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target428 putative iron-sulfur cluster assembly protein [Candidat
1vh4_A435 Crystal Structure Of A Stabilizer Of Iron Transport 4e-67
2zu0_A423 Crystal Structure Of Sufc-Sufd Complex Involved In 1e-66
>gi|40889898|pdb|1VH4|A Chain A, Crystal Structure Of A Stabilizer Of Iron Transporter Length = 435 Back     alignment and structure
 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 90/388 (23%), Positives = 164/388 (42%), Gaps = 10/388 (2%)

Query: 44  LLPTRKIENWHYTDLKNILKVLPTNKN-SIATLQKKYKPLVADSIQLSISQQPSSSILKE 102
            LPTRK ENW YT L+ ++     +    I+  Q+    L  DS++L          L +
Sbjct: 42  GLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGRYVPALSD 101

Query: 103 KNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQA 162
                    +  + +++   L    + +   ++   L+     + +    +   PL L  
Sbjct: 102 ATEGS---GYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLMH 158

Query: 163 IQC------GGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWV 216
           I            H R+ +     +  TV+E + +L +   F  +   I V   A +  +
Sbjct: 159 ITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHI 218

Query: 217 IVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLL 276
            +  +     H     ++L + ++       +G  + R   S  + GE S   +  + + 
Sbjct: 219 KLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMP 278

Query: 277 SGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLL 336
                 D   +L H      S  + + IV +K   VF G ++V+  A  ++ +MT N LL
Sbjct: 279 VKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLL 338

Query: 337 FSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSE 396
                    KP+LEI+ADDV+C HGAT+  I+ E ++YL +RGI++  A  M+ +AF +E
Sbjct: 339 MGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAAE 398

Query: 397 IVEDLNDQVLQFSIEEILSSWLKNNSAN 424
           + E L D+ L+  +   +   L   +  
Sbjct: 399 LTEALRDEGLKQQVLARIGQRLPGGARE 426


gi|224983401|pdb|2ZU0|A Chain A, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 423 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target428 putative iron-sulfur cluster assembly protein [Candidat
1vh4_A435 SUFD protein; structural genomics, protein binding prot 4e-44
>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Length = 435 Back     alignment and structure
 Score =  174 bits (440), Expect = 4e-44
 Identities = 91/395 (23%), Positives = 162/395 (41%), Gaps = 5/395 (1%)

Query: 32  RRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTN-KNSIATLQKKYKPLVADSIQLS 90
            ++ L      GL PTRK ENW YT L+ ++     +    I+  Q+    L  DS++L 
Sbjct: 31  AQQHLQQLLRTGL-PTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLV 89

Query: 91  ISQ---QPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVV 147
                  P+ S   E +   +  +       ++   E           +           
Sbjct: 90  FVDGRYVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQR 149

Query: 148 IPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKV 207
                 L    +  A +     H R+ +     +  TV+E + +L +   F  +   I V
Sbjct: 150 PAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINV 209

Query: 208 GEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEESQ 267
              A +  + +  +     H     ++L + ++       +G  + R   S  + GE S 
Sbjct: 210 AANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENST 269

Query: 268 FMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSN 327
             +  + +       D   +L H      S  + + IV +K   VF G ++V+  A  ++
Sbjct: 270 LRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTD 329

Query: 328 ARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACS 387
            +MT N LL         KP+LEI+ADDV+C HGAT+  I+ E ++YL +RGI++  A  
Sbjct: 330 GQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQ 389

Query: 388 MLSHAFMSEIVEDLNDQVLQFSIEEILSSWLKNNS 422
           M+ +AF +E+ E L D+ L+  +   +   L   +
Sbjct: 390 MIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGA 424


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target428 putative iron-sulfur cluster assembly protein [Candidat
1vh4_A435 SUFD protein; structural genomics, protein binding prot 100.0
1vh4_A435 SUFD protein; structural genomics, protein binding prot 98.43
>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=675.86  Aligned_cols=387  Identities=25%  Similarity=0.377  Sum_probs=343.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCCCC-CCCCCCCCHHHCCCCEEEEEECCCCCCCCCCC----
Q ss_conf             9999999999998283239972474258878977513576443-21111110000158159998346542000445----
Q gi|254781061|r   29 VAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNS-IATLQKKYKPLVADSIQLSISQQPSSSILKEK----  103 (428)
Q Consensus        29 ~~~R~~a~~~F~~~G~lPtkK~E~WKyT~l~~l~~~~~~~~~~-~~~~~~~~~~~~~d~~~i~~~~~~~~~~l~~~----  103 (428)
                      ...|++||++|.++| |||+|+|+||||||++|....+....+ .............+.+.++|.||.+.+.++..    
T Consensus        28 ~~~~~~~~~~f~~~G-lPt~K~E~WKyT~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ivfvnG~~~~~lS~~~e~~  106 (435)
T 1vh4_A           28 SPQAQQHLQQLLRTG-LPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGRYVPALSDATEGS  106 (435)
T ss_dssp             CHHHHHHHHHHHHHC-CCCTTSTTCTTCCCHHHHTSCEECCCCCCCHHHHHHHCCCCCSEEEEEETTEECGGGSCCCTTS
T ss_pred             CHHHHHHHHHHHHHC-CCCCCCCCEECCCHHHHHCCCCCCCCCCCCHHHHCCCCCCCCCEEEEEECCEECHHHCCCCCCC
T ss_conf             099999999999838-8899862720597799744577655776780120112234785389999999813226775568


Q ss_pred             CCCCCCHHHHCCCCHHHCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCEEECCCEEEEEECCCC------CCCEEEEEEC
Q ss_conf             7541005652124201000134555445667887521387487730544770230343202232------2210121001
Q gi|254781061|r  104 NIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQAIQCGG------QMHLRYPISF  177 (428)
Q Consensus       104 ~i~~~~~~~~~~~~~~~~~~~~~~~~d~f~~LN~A~~~~g~~I~V~~~~~~~~PI~i~~~~~~~------~~~~r~~I~v  177 (428)
                      ++.+....       .........+.++|.+||.|++++|++|+||+|.++++||+|+++.++.      ..+||++|++
T Consensus       107 ~i~i~~~~-------~~~~~~~~~~~~~~~~Ln~a~~~~g~~I~V~~n~~~~~PI~I~~~~~~~~~~~~~~~~~r~~I~v  179 (435)
T 1vh4_A          107 GYEVSIND-------DRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDL  179 (435)
T ss_dssp             SCEEEEES-------CCTTCCCCSSCCHHHHHHHHHCSCEEEEEECTTCCCSSCEEEEEEECCCSSSCEEEEEEEEEEEE
T ss_pred             CEEEECHH-------HHHHHHHHHCCCHHHHHHHHHHCCEEEEEEECCEECCCCEEEEEEECCCCCCCCCEEEEEEEEEE
T ss_conf             72995267-------76540444301077999886534647999703400156459999612446655530346789997


Q ss_pred             CCCCCEEEEEECCCCCCCCEEECCCEEEEECCCCEEEEEECCCCCCCEEEEEECEEEECCCCCEEEEEEECCCCCEEEEE
Q ss_conf             79861355530356675520100312899648863766300245653014320001120355146778642565124433
Q gi|254781061|r  178 GMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRREL  257 (428)
Q Consensus       178 ~~ns~~~iiE~~~~~~~~~~~~n~~~ei~l~~~A~l~~~~iq~~~~~s~~~~~~~~~~~~~S~~~~~~~~~Gg~~~R~~i  257 (428)
                      ++||+++|+|.|.+.+...+|++.+++|.+++||+|+|+++|+++.+++++...++.++++|.|+++++.+|+.++|+++
T Consensus       180 ~~ns~vtIie~~~~~~~~~~~~n~v~ei~l~enA~L~~~~iq~~~~~~~~~~~~~~~~~~~S~~~~~~~~~g~~~~r~~~  259 (435)
T 1vh4_A          180 AEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNT  259 (435)
T ss_dssp             CTTCEEEEEEEEEESSSSCEEEEEEEEEEECTTCEEEEEEEECCCTTCEEEEEEEEEECTTCEEEEEEEECCCSEEEEEE
T ss_pred             CCCCCEEEEEEEECCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCEEEEEEEEECCCCCEEEEEEECCCCEEEEEC
T ss_conf             48985279997503786410231369999807808999998505775410002368864787369988851774147620


Q ss_pred             EEEEECCCCEEEEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEEECCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             56651354124663344227441001112222127775268887300048852787410101366410000000004661
Q gi|254781061|r  258 SIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGSNARMTANTLLF  337 (428)
Q Consensus       258 ~i~L~Ge~a~~~~~g~~l~~~~q~~D~~~~i~H~~~~t~S~~~~k~vl~d~s~~vf~G~i~V~~~a~~t~~~q~~~~llL  337 (428)
                      ++.|+|+||+++++|+++++++|++|+++.|+|.+|+|+|+|.+|+|++|+|++||+|+|+|.++|++|+|+|.|++|||
T Consensus       260 ~~~L~G~ga~~~~~g~~~~~~~q~~D~~~~i~H~~~~t~S~~~~k~Vl~d~s~~vf~G~i~I~~~A~~t~a~q~~~~lll  339 (435)
T 1vh4_A          260 STQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLM  339 (435)
T ss_dssp             EEEECSTTCEEEEEEEECCCTTCEEEEEEEEEECSSSCEEEEEEEEEECTTCEEEEEEEEEECTTCTTEEEEEEEEEEEC
T ss_pred             CCCCCCCCCEEEEEEEEECCCCEEEEEEEEEEECCCCCEEEEEEECCCCCCCCEEEEEEEEECCCCHHHHHHHEECEEEE
T ss_conf             11145664304566677258986885210004237980688721023226870499630200555126666320043981


Q ss_pred             CCCEEEEEEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             28717981212477138733655422123899999999946889899999999999999988589789999999999999
Q gi|254781061|r  338 SNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSW  417 (428)
Q Consensus       338 s~~a~~~s~P~LeI~~ddV~~~Hgatvg~id~e~lfYl~sRGi~~~~A~~lli~gF~~~~i~~i~~~~~~~~~~~~i~~~  417 (428)
                      |++|+++|+|+|||++|||+|+||||||+||+|||||||||||++++|++|||.||++|++++||++.+|+++.+.|++|
T Consensus       340 s~~a~~~s~P~LeI~~ddV~~sHgatvg~id~e~lfYL~SRGi~~~~A~~llv~gF~~~v~~~i~~~~l~~~v~~~i~~~  419 (435)
T 1vh4_A          340 GKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQR  419 (435)
T ss_dssp             STTCEEEEEEEEEECCSSEEEEEEEEEECCCHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHTT
T ss_pred             CCCCEEEECEEEEEECCCEEEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             48834876504899539737995132467898999999876999999999999997999998699699999999999987


Q ss_pred             HHHCCC
Q ss_conf             741387
Q gi|254781061|r  418 LKNNSA  423 (428)
Q Consensus       418 l~~~~~  423 (428)
                      |+..+.
T Consensus       420 l~~~~~  425 (435)
T 1vh4_A          420 LPGGAR  425 (435)
T ss_dssp             STTC--
T ss_pred             HHCHHH
T ss_conf             413022



>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 428 putative iron-sulfur cluster assembly protein [Candidat
d1vh4a_413 b.80.6.1 (A:) Stabilizer of iron transporter SufD {Esch 3e-43
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Length = 413 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Stabilizer of iron transporter SufD
family: Stabilizer of iron transporter SufD
domain: Stabilizer of iron transporter SufD
species: Escherichia coli [TaxId: 562]
 Score =  169 bits (429), Expect = 3e-43
 Identities = 91/392 (23%), Positives = 162/392 (41%), Gaps = 7/392 (1%)

Query: 32  RRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTN-KNSIATLQKKYKPLVADSIQLS 90
            ++ L      GL PTRK ENW YT L+ ++     +    I+  Q+    L  DS++L 
Sbjct: 21  AQQHLQQLLRTGL-PTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLV 79

Query: 91  I----SQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKV 146
                     S   +    EV      +   +       L   +++      ++      
Sbjct: 80  FVDGRYVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRG-Q 138

Query: 147 VIPDECQLNVPLELQAIQCGGQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIK 206
                  L    +  A +     H R+ +     +  TV+E + +L +   F  +   I 
Sbjct: 139 RPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTIN 198

Query: 207 VGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDVKGEES 266
           V   A +  + +  +     H     ++L + ++       +G  + R   S  + GE S
Sbjct: 199 VAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENS 258

Query: 267 QFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSSEAQGS 326
              +  + +       D   +L H      S  + + IV +K   VF G ++V+  A  +
Sbjct: 259 TLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKT 318

Query: 327 NARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQAC 386
           + +MT N LL         KP+LEI+ADDV+C HGAT+  I+ E ++YL +RGI++  A 
Sbjct: 319 DGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQ 378

Query: 387 SMLSHAFMSEIVEDLNDQVLQFSIEEILSSWL 418
            M+ +AF +E+ E L D+ L+  +   +   L
Sbjct: 379 QMIIYAFAAELTEALRDEGLKQQVLARIGQRL 410


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target428 putative iron-sulfur cluster assembly protein [Candidat
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia coli [ 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia coli [ 98.37
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Stabilizer of iron transporter SufD
family: Stabilizer of iron transporter SufD
domain: Stabilizer of iron transporter SufD
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=674.09  Aligned_cols=400  Identities=24%  Similarity=0.360  Sum_probs=350.5

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCCCC-CCCCCCCCHHHCCC
Q ss_conf             99999999999986178877899999999999998283239972474258878977513576443-21111110000158
Q gi|254781061|r    7 VETMLLQSCDEACQKYYRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNS-IATLQKKYKPLVAD   85 (428)
Q Consensus         7 ~~~~l~~~f~~~~~~~~~~~~~~~~R~~a~~~F~~~G~lPtkK~E~WKyT~l~~l~~~~~~~~~~-~~~~~~~~~~~~~d   85 (428)
                      +.+++++.|+....      +..+.|+++|++|.++| |||+|+|+||||||++|....+....+ .............+
T Consensus         2 ~~~~~~~~~~~~~~------~~~~~~~~~l~~f~~~G-lPt~k~E~WKyT~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~   74 (413)
T d1vh4a_           2 ALQQWHHLFEAEGT------KRSPQAQQHLQQLLRTG-LPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLD   74 (413)
T ss_dssp             HHHHHHHHHHC---------CCCHHHHHHHHHHHHHC-CCCTTSTTCTTCCCHHHHTSCEECCCCCCCHHHHHHHCCCCC
T ss_pred             HHHHHHHHHHHCCC------CCHHHHHHHHHHHHHCC-CCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCHHHCCCCCCCC
T ss_conf             78999999986288------46299999999999729-889987281479879974357765677668002000234568


Q ss_pred             CEEEEEECCCCCCCCCCC----CCCCCCHHHHCCCCHHHCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCEEECCCEEEE
Q ss_conf             159998346542000445----7541005652124201000134555445667887521387487730544770230343
Q gi|254781061|r   86 SIQLSISQQPSSSILKEK----NIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQ  161 (428)
Q Consensus        86 ~~~i~~~~~~~~~~l~~~----~i~~~~~~~~~~~~~~~~~~~~~~~~d~f~~LN~A~~~~g~~I~V~~~~~~~~PI~i~  161 (428)
                      .+.++|.+|.+.+.++..    ++.+....       ...........++|.+||.|++++|++|+||+|+++++||+|+
T Consensus        75 ~~~ivfvnG~~~~~ls~~~~~~~i~i~~~~-------~~~~~~~~~~~~~~~~LN~a~~~~g~~I~V~~~~~~~~PI~i~  147 (413)
T d1vh4a_          75 SVRLVFVDGRYVPALSDATEGSGYEVSIND-------DRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLM  147 (413)
T ss_dssp             SEEEEEETTEECGGGSCCCTTSSCEEEEES-------CCTTCCCCSSCCHHHHHHHHHCSCEEEEEECTTCCCSSCEEEE
T ss_pred             CEEEEEECCEECHHCCCCCCCCCEEEECHH-------HHHHCCCCHHHHHHHHHHHHCCCCCEEEEECCCEEECCCCEEE
T ss_conf             548999899982100567555772885157-------5540411011001233232102543267412535760454146


Q ss_pred             EECCC------CCCCEEEEEECCCCCCEEEEEECCCCCCCCEEECCCEEEEECCCCEEEEEECCCCCCCEEEEEECEEEE
Q ss_conf             20223------222101210017986135553035667552010031289964886376630024565301432000112
Q gi|254781061|r  162 AIQCG------GQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVIL  235 (428)
Q Consensus       162 ~~~~~------~~~~~r~~I~v~~ns~~~iiE~~~~~~~~~~~~n~~~ei~l~~~A~l~~~~iq~~~~~s~~~~~~~~~~  235 (428)
                      ++.++      ...+||++|++++||+++|+|.|.+.+...+|++++++|.+++||+|+|+++|+++.+++++...++.+
T Consensus       148 ~~~~~~~~~~~~~~~~r~~I~v~ena~v~iiE~~~~~~~~~~~~n~~~ei~l~~nA~l~~~~iq~~~~~~~~~~~~~~~~  227 (413)
T d1vh4a_         148 HITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLL  227 (413)
T ss_dssp             EEECCCSSSCEEEEEEEEEEEECTTCEEEEEEEEEESSSSCEEEEEEEEEEECTTCEEEEEEEECCCTTCEEEEEEEEEE
T ss_pred             EEECCCCCCCCCCCCEEEEEEECCCCHHHHHHHCCCCCCCCCEECCEEEEEECCCCEEEEHHHHHHCCCCCCCCEEEEEC
T ss_conf             75036443443331114565305520221112114554410000220589952664243033444223342122011200


Q ss_pred             CCCCCEEEEEEECCCCCEEEEEEEEEECCCCEEEEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEEEC
Q ss_conf             03551467786425651244335665135412466334422744100111222212777526888730004885278741
Q gi|254781061|r  236 EKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQG  315 (428)
Q Consensus       236 ~~~S~~~~~~~~~Gg~~~R~~i~i~L~Ge~a~~~~~g~~l~~~~q~~D~~~~i~H~~~~t~S~~~~k~vl~d~s~~vf~G  315 (428)
                      +++|.|+++++.+|+.++|.++++.|.|+||+++++|++++.++|++|+++.|+|.+|+|+|+|.+|||+.|+|++||+|
T Consensus       228 ~~~s~~~~~~~~~G~~~~r~~~~~~L~G~~a~~~~~g~~~~~~~q~~D~~~~i~H~~~~t~S~~~~k~vl~d~s~~vf~G  307 (413)
T d1vh4a_         228 AEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNG  307 (413)
T ss_dssp             CTTCEEEEEEEECCCSEEEEEEEEEECSTTCEEEEEEEECCCTTCEEEEEEEEEECSSSCEEEEEEEEEECTTCEEEEEE
T ss_pred             CCCCCEEEEECCCCCCHHHCCCHHHCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHHHHCCCCCCCEEEEEE
T ss_conf             34541465320002110011000011200011001102346642243322232015554204134312466664048865


Q ss_pred             CCCCCCCCCCCCCCEEEEEEEECCCEEEEEEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             01013664100000000046612871798121247713873365542212389999999994688989999999999999
Q gi|254781061|r  316 AVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMS  395 (428)
Q Consensus       316 ~i~V~~~a~~t~~~q~~~~llLs~~a~~~s~P~LeI~~ddV~~~Hgatvg~id~e~lfYl~sRGi~~~~A~~lli~gF~~  395 (428)
                      +|+|.++|++|+|+|.|++||||++|+++|+|+|||++|||+|+||||||+||+|||||||||||++++|++||++||++
T Consensus       308 ~i~V~~~A~~t~a~q~~~~llls~~a~~~s~P~Lei~~ddv~~~Hgatvg~id~~~lfYL~sRGi~~~eA~~ll~~gF~~  387 (413)
T d1vh4a_         308 LINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAA  387 (413)
T ss_dssp             EEEECTTCTTEEEEEEEEEEECSTTCEEEEEEEEEECCSSEEEEEEEEEECCCHHHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCEEEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             30356552256657766530156774487552289963981699400046789899999997699999999999999899


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9988589789999999999999741
Q gi|254781061|r  396 EIVEDLNDQVLQFSIEEILSSWLKN  420 (428)
Q Consensus       396 ~~i~~i~~~~~~~~~~~~i~~~l~~  420 (428)
                      |++++||++.+|+++.+.|++||..
T Consensus       388 ~~~~~~~~~~~~~~~~~~i~~~l~~  412 (413)
T d1vh4a_         388 ELTEALRDEGLKQQVLARIGQRLPG  412 (413)
T ss_dssp             HHHTTCCCHHHHHHHHHHHHTTSTT
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHCC
T ss_conf             9998698299999999999987248



>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 428 putative iron-sulfur cluster assembly protein [Can
1vh4_A_435 (A:) SUFD protein; structural genomics, protein bi 2e-58
>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli}Length = 435 Back     alignment and structure
 Score =  221 bits (563), Expect = 2e-58
 Identities = 92/397 (23%), Positives = 165/397 (41%), Gaps = 13/397 (3%)

Query: 30  AFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIATLQKKYKPLV--ADSI 87
              ++ L      GL PTRK ENW YT L+ ++        +     ++   L    DS+
Sbjct: 29  PQAQQHLQQLLRTGL-PTRKHENWKYTPLEGLIN-SQFVSIAGEISPQQRDALALTLDSV 86

Query: 88  QLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVV 147
           +L          L +          I   +++   L    + +   ++   L+     + 
Sbjct: 87  RLVFVDGRYVPALSDATEGSGYEVSI---NDDRQGLPDAIQAEVFLHLTESLAQSVTHIA 143

Query: 148 IPDECQLNVPLELQAIQCG------GQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSS 201
           +    +   PL L  I  G         H R+ +     +  TV+E + +L +   F  +
Sbjct: 144 VKRGQRPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGA 203

Query: 202 IADIKVGEGADITWVIVLDQGIEDTHLGQLRVILEKKSSLKVFVLNIGQGLSRRELSIDV 261
              I V   A +  + +  +     H     ++L + ++       +G  + R   S  +
Sbjct: 204 RFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQL 263

Query: 262 KGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQGAVHVSS 321
            GE S   +  + +       D   +L H      S  + + IV +K   VF G ++V+ 
Sbjct: 264 NGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQ 323

Query: 322 EAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGIS 381
            A  ++ +MT N LL         KP+LEI+ADDV+C HGAT+  I+ E ++YL +RGI+
Sbjct: 324 HAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGIN 383

Query: 382 KNQACSMLSHAFMSEIVEDLNDQVLQFSIEEILSSWL 418
           +  A  M+ +AF +E+ E L D+ L+  +   +   L
Sbjct: 384 QQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRL 420


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target428 putative iron-sulfur cluster assembly protein [Candidat
1vh4_A_435 SUFD protein; structural genomics, protein binding 100.0
1vh4_A_435 SUFD protein; structural genomics, protein binding 98.42
>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=649.89  Aligned_cols=415  Identities=23%  Similarity=0.335  Sum_probs=371.7

Q ss_pred             CCHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC-CCCCCHH
Q ss_conf             3279999999999998617-8877899999999999998283239972474258878977513576443211-1111000
Q gi|254781061|r    4 LTAVETMLLQSCDEACQKY-YRNQSVVAFRRRLLCDFRTQGLLPTRKIENWHYTDLKNILKVLPTNKNSIAT-LQKKYKP   81 (428)
Q Consensus         4 ~t~~~~~l~~~f~~~~~~~-~~~~~~~~~R~~a~~~F~~~G~lPtkK~E~WKyT~l~~l~~~~~~~~~~~~~-~~~~~~~   81 (428)
                      |++....+.+.+...++.. ..+.|+.++|++|++.|+++| ||++|+|.|||||++.+....+........ .......
T Consensus         2 m~~~~~~l~~~~~~~~s~~~~ep~wl~~~R~~a~~~~~~l~-~P~~~~e~wryt~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (435)
T 1vh4_A            2 LMAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTG-LPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALA   80 (435)
T ss_dssp             ---------CHHHHHHHHHHC---CCCHHHHHHHHHHHHHC-CCCTTSTTCTTCCCHHHHTSCEECCCCCCCHHHHHHHC
T ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHC-CCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCHHHHHCC
T ss_conf             54558887699999999986227747599999999999829-78998708137987997454776557766800210001


Q ss_pred             HCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHCCCCHHHCCCCCCCCCCHHHHHHHHHCCCCEEEEEECCEEECCCEEEE
Q ss_conf             01581599983465420004457541005652124201000134555445667887521387487730544770230343
Q gi|254781061|r   82 LVADSIQLSISQQPSSSILKEKNIEVLPFSHIENTDENSYCLEPLSEHDTIGYINGILSNDGYKVVIPDECQLNVPLELQ  161 (428)
Q Consensus        82 ~~~d~~~i~~~~~~~~~~l~~~~i~~~~~~~~~~~~~~~~~~~~~~~~d~f~~LN~A~~~~g~~I~V~~~~~~~~PI~i~  161 (428)
                      ...+...+++.++.+.+.++..........   ...............++|.+||.|++++|++|+||+++++++||+++
T Consensus        81 ~~~~~~~~~~v~g~~~~~~~~l~~~~~~~~---~~~~~~~~~~~~~~~~~~~aln~a~~~~g~~i~v~~~~~~~~Pi~i~  157 (435)
T 1vh4_A           81 LTLDSVRLVFVDGRYVPALSDATEGSGYEV---SINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPLLLM  157 (435)
T ss_dssp             CCCCSEEEEEETTEECGGGSCCCTTSSCEE---EEESCCTTCCCCSSCCHHHHHHHHHCSCEEEEEECTTCCCSSCEEEE
T ss_pred             CCCCCEEEEEECCEECCCCCCCCCCCCEEE---ECHHHHHHHHHHHHHHHHHHHHHHHCCCCCEECCCCCEEECCCCEEE
T ss_conf             346760599778888120156755676076---23777753054442257899876230233201014524750453036


Q ss_pred             EECCC------CCCCEEEEEECCCCCCEEEEEECCCCCCCCEEECCCEEEEECCCCEEEEEECCCCCCCEEEEEECEEEE
Q ss_conf             20223------222101210017986135553035667552010031289964886376630024565301432000112
Q gi|254781061|r  162 AIQCG------GQMHLRYPISFGMNSRTTVVERYTTLTNDNSFVSSIADIKVGEGADITWVIVLDQGIEDTHLGQLRVIL  235 (428)
Q Consensus       162 ~~~~~------~~~~~r~~I~v~~ns~~~iiE~~~~~~~~~~~~n~~~ei~l~~~A~l~~~~iq~~~~~s~~~~~~~~~~  235 (428)
                      ++..+      ...++|++|++++||+++|+|.|.+.....+|++.++++++++||+|+|+.+|+++..++++...++.+
T Consensus       158 ~~~~~~~~~~~~~~~~~~~i~~~~~s~~~iie~~~~~~~~~~~~~~~~ei~~~~~A~l~~~~i~~~~~~~~~~~~~~~~~  237 (435)
T 1vh4_A          158 HITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDARHFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLL  237 (435)
T ss_dssp             EEECCCSSSCEEEEEEEEEEEECTTCEEEEEEEEEESSSSCEEEEEEEEEEECTTCEEEEEEEECCCTTCEEEEEEEEEE
T ss_pred             EEECCCCCCCCCCEEEEEEEEECCCCHHHHHHHHCCCCCHHHHCCCEEEEEECCCCEEEEHHHHHCCCCCCCCCHHHHHH
T ss_conf             75036454444420157899742530345555421221001000421689841443343001343034432120222102


Q ss_pred             CCCCCEEEEEEECCCCCEEEEEEEEEECCCCEEEEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEEEEECCCCEEEEEC
Q ss_conf             03551467786425651244335665135412466334422744100111222212777526888730004885278741
Q gi|254781061|r  236 EKKSSLKVFVLNIGQGLSRRELSIDVKGEESQFMLRGINLLSGKAHSDLSMFLRHKVPNTCSTSVIRNIVLEKSTGVFQG  315 (428)
Q Consensus       236 ~~~S~~~~~~~~~Gg~~~R~~i~i~L~Ge~a~~~~~g~~l~~~~q~~D~~~~i~H~~~~t~S~~~~k~vl~d~s~~vf~G  315 (428)
                      +++|++++.++.+||+++|+++.+.|.|+||+++++|++++.++|+.|+++.|+|.+|+|+|+|++|||+.|+|+++|+|
T Consensus       238 ~~~a~~~~~~~~~g~~~~~~~~~~~l~g~~a~~~~~g~~~~~~~q~~d~~~~v~h~~~~t~s~~~~k~vl~d~s~~vf~G  317 (435)
T 1vh4_A          238 AEDATAFSHSFLLGGAVLRHNTSTQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNG  317 (435)
T ss_dssp             CTTCEEEEEEEECCCSEEEEEEEEEECSTTCEEEEEEEECCCTTCEEEEEEEEEECSSSCEEEEEEEEEECTTCEEEEEE
T ss_pred             CCCCCEEEEEECCCCCEEEEECCCCCCCCHHHEEEEECCCCCCCHHHHHHHHHHCCCCCCCCEEHHCCCCCCCCEEEEEE
T ss_conf             35652389864156511110011114400111001102456630364543222015553222002103333686269854


Q ss_pred             CCCCCCCCCCCCCCEEEEEEEECCCEEEEEEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             01013664100000000046612871798121247713873365542212389999999994688989999999999999
Q gi|254781061|r  316 AVHVSSEAQGSNARMTANTLLFSNEGSFYVKPELEIFADDVQCGHGATISDINPEHLYYLMARGISKNQACSMLSHAFMS  395 (428)
Q Consensus       316 ~i~V~~~a~~t~~~q~~~~llLs~~a~~~s~P~LeI~~ddV~~~Hgatvg~id~e~lfYl~sRGi~~~~A~~lli~gF~~  395 (428)
                      +|+|.++|+||+|+|.|++||||++|+++|+|.|||++|||+|+||||||+||+|||||||||||++++|++||+.||++
T Consensus       318 ~i~i~~~A~~s~a~q~~~~LlLs~~A~~~s~P~LeI~~dDV~~sHgAtvG~id~e~LFYL~SRGi~~~~A~~Llv~gF~~  397 (435)
T 1vh4_A          318 LINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQDAQQMIIYAFAA  397 (435)
T ss_dssp             EEEECTTCTTEEEEEEEEEEECSTTCEEEEEEEEEECCSSEEEEEEEEEECCCHHHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHEEEECCCCEEEECCEEEEECCCEEEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             40336663166767655406505884166562389963972699402146789899999987699999999999999899


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             998858978999999999999974138
Q gi|254781061|r  396 EIVEDLNDQVLQFSIEEILSSWLKNNS  422 (428)
Q Consensus       396 ~~i~~i~~~~~~~~~~~~i~~~l~~~~  422 (428)
                      |++++||++.+|+++.+.|++||....
T Consensus       398 ~vl~~i~~e~lr~~i~~~i~~~l~~~~  424 (435)
T 1vh4_A          398 ELTEALRDEGLKQQVLARIGQRLPGGA  424 (435)
T ss_dssp             HHHTTCCCHHHHHHHHHHHHTTSTTC-
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             999869859999999999998611422



>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} Back     alignment and structure