254781062

254781062

putative aminotransferase involved in iron-sulfur cluster biogenesis

GeneID in NCBI database:8210085Locus tag:CLIBASIA_04820
Protein GI in NCBI database:254781062Protein Accession:YP_003065475.1
Gene range:+(1066273, 1067493)Protein Length:406aa
Gene description:putative aminotransferase involved in iron-sulfur cluster biogenesis
COG prediction:[E] Selenocysteine lyase
KEGG prediction:putative aminotransferase involved in iron-sulfur cluster biogenesis; K11717 cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
SEED prediction:Cysteine desulfurase (EC 2.8.1.7), SufS subfamily
Pathway involved in KEGG:Selenoamino acid metabolism [PATH:las00450]
Thiamine metabolism [PATH:las00730]
Subsystem involved in SEED:tRNA modification Archaea;
Alanine biosynthesis;
Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
ccccHHHHHHHccccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccHHEEEEEccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHcccccEEEEEEcccccccEEccHHHHHHHHHHcccEEEEEcccccccccccHHHccccEEEEEcHHcccccccEEEEEcHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccEEEEEEccccHHHHHHHHHHcccEEEEccccccHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHc
ccccHHHHHHccHHHHcEEccEEcEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEccHHHHHHHHHHHcHHHHcccccEEEEEccccHHHcHHHHHHHHHHccEEEEEcEcccccEcHHHHHHHccccEEEEEEEcEccccccEccHHHHHHHHHHcccEEEEEcccccccccccHHHHcccEEEEEHHHcccccccEEEEEcHHHHHHccccccccccEEEEEccEEEEccccHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEEEccccHHHHHHHHHHccEEcEEEccccHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHc
mtfdinsirkdfpilgrdirkkpliyfdnaasaqkpqdvIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLvsygwgarhistGDEIVLSVMEHhsniipwyflrqrrgaslvwvpidnqgffhIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIahernipvlvdgsqgsvhnfvdvqdidcdwyiitghklygpsgigglyskesrlnemdpfmggsemiADVTQDMVtyadlpyrfepgtppisQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMqlvnesledspiisfrlgnihpydlalfldgegiairagthcanpllkflGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
mtfdinsirkdfpilgrdirKKPLIYFDNaasaqkpqdVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFinassvkeiiftrsatesiNLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIdrksifsyeRELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
*TFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
*TFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ
MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHYMANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSVMEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTVIPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKSIFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRAGTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFFQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target406 putative aminotransferase involved in iron-sulfur clust
254781091383 putative pyridoxal-phosphate-dependent aminotransf 4e-17
>gi|254781091|ref|YP_003065504.1| putative pyridoxal-phosphate-dependent aminotransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 383 Back     alignment
 Score = 80.9 bits (198), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 88/356 (24%), Positives = 158/356 (44%), Gaps = 47/356 (13%)

Query: 70  EKARDKVRRFINASSVKEIIFTRSATESIN--LVSYGWGARHISTGDEIVLSVMEHHSNI 127
           E++R  +  F  A     ++FT SATE+ N  L  + +   H  + D + +S +EH +  
Sbjct: 48  EESRRIIADFCGAKP-DHVVFTSSATEAANWVLTPHFYQGSHKISIDSLYISAIEHPAVY 106

Query: 128 IPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTK-----LIAITHMSNVLGTVIP 182
              +F   +    +  +P+ ++G   I    + L +R       +IA+  ++N  G + P
Sbjct: 107 AGGHFPSHK----IHKIPVLSKGIVDIQALTDFLEQRNSTCGIPMIAVMFVNNETGVIQP 162

Query: 183 IKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKESR 242
           IKEI +I  E    ++VD  Q +    + +++I  D+ II+ HKL  P G G L  +E  
Sbjct: 163 IKEIAQIVKEYQGILVVDAVQAAGRIPLSIEEIKADFLIISSHKLGAPVGAGALVFREDI 222

Query: 243 LNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKS-- 300
           L    P + G +           YA +             A+A   A   V+ I ++S  
Sbjct: 223 LLP-SPLLRGGDQEKGQRAGTENYAVIG----------GFAVA---AQQMVKDIQKRSSR 268

Query: 301 IFS----YERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGI 356
           +F+     E+EL + + + +   +  + ++ +        F +  +    L + LD EGI
Sbjct: 269 VFAIRDYLEQELKKLIPNIIIYGKDAERISNTC------CFSIPFLKAEVLQIALDLEGI 322

Query: 357 AIRAGTHCA------NPLLKFLGIDS---LCRASLAMYNTYEEADKFIETLKKSIQ 403
           A+ AG+ C+      N +L  +G D+     R S     T E+ D F+  L+K I+
Sbjct: 323 AVSAGSACSSGKIKKNHVLAAMGFDTSQGAVRVSCGDSTTQEDIDIFLNALQKIIR 378

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target406 putative aminotransferase involved in iron-sulfur clust
315122402406 putative aminotransferase involved in iron-sulfur clust 1 0.0
241204823413 cysteine desulfurase, SufS subfamily [Rhizobium legumin 1 1e-155
116252324413 aminotransferase involved in iron-sulfur cluster biogen 1 1e-155
218463660413 cysteine desulfurase, SufS subfamily protein [Rhizobium 1 1e-155
209549490413 cysteine desulfurase, SufS subfamily [Rhizobium legumin 1 1e-155
325293223416 cysteine desulfurase [Agrobacterium sp. H13-3] Length = 1 1e-154
190891948413 selenocysteine lyase [Rhizobium etli CIAT 652] Length = 1 1e-153
159184934408 cysteine desulfurase [Agrobacterium tumefaciens str. C5 1 1e-153
86357864413 putative selenocysteine lyase protein [Rhizobium etli C 1 1e-152
222148793416 aminotransferase [Agrobacterium vitis S4] Length = 416 1 1e-152
>gi|315122402|ref|YP_004062891.1| putative aminotransferase involved in iron-sulfur cluster biogenesis [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 406 Back     alignment and organism information
 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/405 (83%), Positives = 372/405 (91%)

Query: 1   MTFDINSIRKDFPILGRDIRKKPLIYFDNAASAQKPQDVIDSIMCTYSHEYANIHRGLHY 60
           MTFD+N IRK+FPIL R IR KPLIYFDNAASAQKPQDVIDSI+ TYS+EYANIHRGLHY
Sbjct: 1   MTFDVNLIRKNFPILNRYIRNKPLIYFDNAASAQKPQDVIDSIIHTYSYEYANIHRGLHY 60

Query: 61  MANAVTDKYEKARDKVRRFINASSVKEIIFTRSATESINLVSYGWGARHISTGDEIVLSV 120
           MAN VTDKYE+ARDKVR FINASSVKEIIFTRSATESINLVSYGWG +HIS GDEIVLSV
Sbjct: 61  MANVVTDKYEEARDKVRCFINASSVKEIIFTRSATESINLVSYGWGLKHISAGDEIVLSV 120

Query: 121 MEHHSNIIPWYFLRQRRGASLVWVPIDNQGFFHIDEFKNRLTERTKLIAITHMSNVLGTV 180
           MEHHSNI+PW+FLRQR GA LVW PIDNQGF  IDEFK  LTERTKLIAITHMSN+LGT+
Sbjct: 121 MEHHSNIVPWHFLRQRCGARLVWAPIDNQGFLKIDEFKKCLTERTKLIAITHMSNILGTI 180

Query: 181 IPIKEICRIAHERNIPVLVDGSQGSVHNFVDVQDIDCDWYIITGHKLYGPSGIGGLYSKE 240
           +PIKEICRIA ERNIPVL+DGSQG+VHNFVDVQDI+CDWY+ITGHKLYGPSGIG LY KE
Sbjct: 181 VPIKEICRIAQERNIPVLIDGSQGAVHNFVDVQDINCDWYVITGHKLYGPSGIGALYGKE 240

Query: 241 SRLNEMDPFMGGSEMIADVTQDMVTYADLPYRFEPGTPPISQAIALGVALDYVEKIDRKS 300
           SRLNEM+PFMGG EMI+DVTQD VTYADLPYRFEPGTPPI+QAIALG+ALDY+EKI RK 
Sbjct: 241 SRLNEMEPFMGGGEMISDVTQDTVTYADLPYRFEPGTPPIAQAIALGIALDYIEKIGRKF 300

Query: 301 IFSYERELARYVRSRLKEVRGMQLVNESLEDSPIISFRLGNIHPYDLALFLDGEGIAIRA 360
           IFSYERELARY R+RLKEV G+QLVN+S+EDSPI+SF+L NI+P+DL+LFLDGEGIA RA
Sbjct: 301 IFSYERELARYTRARLKEVDGLQLVNDSVEDSPIMSFKLDNIYPHDLSLFLDGEGIATRA 360

Query: 361 GTHCANPLLKFLGIDSLCRASLAMYNTYEEADKFIETLKKSIQFF 405
           G  CANPLLKFLG+D LCRASLAMYNTYEE+D FIE+LKKS  FF
Sbjct: 361 GKSCANPLLKFLGVDYLCRASLAMYNTYEESDVFIESLKKSKSFF 405


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241204823|ref|YP_002975919.1| cysteine desulfurase, SufS subfamily [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 413 Back     alignment and organism information
>gi|116252324|ref|YP_768162.1| aminotransferase involved in iron-sulfur cluster biogenesis [Rhizobium leguminosarum bv. viciae 3841] Length = 413 Back     alignment and organism information
>gi|218463660|ref|ZP_03503751.1| cysteine desulfurase, SufS subfamily protein [Rhizobium etli Kim 5] Length = 413 Back     alignment and organism information
>gi|209549490|ref|YP_002281407.1| cysteine desulfurase, SufS subfamily [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 413 Back     alignment and organism information
>gi|325293223|ref|YP_004279087.1| cysteine desulfurase [Agrobacterium sp. H13-3] Length = 416 Back     alignment and organism information
>gi|190891948|ref|YP_001978490.1| selenocysteine lyase [Rhizobium etli CIAT 652] Length = 413 Back     alignment and organism information
>gi|159184934|ref|NP_354805.2| cysteine desulfurase [Agrobacterium tumefaciens str. C58] Length = 408 Back     alignment and organism information
>gi|86357864|ref|YP_469756.1| putative selenocysteine lyase protein [Rhizobium etli CFN 42] Length = 413 Back     alignment and organism information
>gi|222148793|ref|YP_002549750.1| aminotransferase [Agrobacterium vitis S4] Length = 416 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target406 putative aminotransferase involved in iron-sulfur clust
TIGR01979403 TIGR01979, sufS, cysteine desulfurases, SufS subfamily 1e-164
COG0520405 COG0520, CsdB, Selenocysteine lyase [Amino acid transpo 1e-131
PLN02855424 PLN02855, PLN02855, Bifunctional selenocysteine lyase/c 1e-130
PRK09295406 PRK09295, PRK09295, bifunctional cysteine desulfurase/s 1e-128
pfam00266371 pfam00266, Aminotran_5, Aminotransferase class-V 1e-126
PRK10874401 PRK10874, PRK10874, cysteine sulfinate desulfinase; Pro 1e-103
TIGR03392398 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalyti 4e-97
TIGR01977376 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family 1e-61
KOG1549428 KOG1549, KOG1549, KOG1549, Cysteine desulfurase NFS1 [A 5e-56
TIGR01976397 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family 7e-55
COG1104386 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine 1e-50
TIGR03402379 TIGR03402, FeS_nifS, cysteine desulfurase NifS 1e-36
TIGR03403382 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS fam 3e-33
TIGR02006402 TIGR02006, IscS, cysteine desulfurase IscS 2e-31
PLN02651364 PLN02651, PLN02651, cysteine desulfurase 5e-30
PRK14012404 PRK14012, PRK14012, cysteine desulfurase; Provisional 3e-29
PRK02948381 PRK02948, PRK02948, cysteine desulfurase; Provisional 8e-18
cd06453373 cd06453, SufS_like, Cysteine desulfurase (SufS)-like 1e-166
TIGR03235353 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA 2e-30
COG0076460 COG0076, GadB, Glutamate decarboxylase and related PLP- 2e-11
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) superf 9e-21
COG1103382 COG1103, COG1103, Archaea-specific pyridoxal phosphate- 2e-07
TIGR02539370 TIGR02539, SepCysS, Sep-tRNA:Cys-tRNA synthase 8e-05
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase/arch 2e-10
PRK08363398 PRK08363, PRK08363, alanine aminotransferase; Validated 1e-07
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase 2e-07
PLN02409401 PLN02409, PLN02409, serine--glyoxylate aminotransaminas 3e-04
cd06452361 cd06452, SepCysS, Sep-tRNA:Cys-tRNA synthase 3e-08
PRK09331387 PRK09331, PRK09331, Sep-tRNA:Cys-tRNA synthetase; Provi 2e-06
COG2873426 COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino 2e-05
pfam01053381 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-depe 2e-05
cd00616352 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid syntha 3e-05
TIGR00474454 TIGR00474, selA, seryl-tRNA(sec) selenium transferase 6e-05
PRK00950361 PRK00950, PRK00950, histidinol-phosphate aminotransfera 6e-05
pfam03841367 pfam03841, SelA, L-seryl-tRNA selenium transferase 0.001
TIGR01329378 TIGR01329, cysta_beta_ly_E, cystathionine beta-lyase, e 0.001
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 4e-07
COG0399374 COG0399, WecE, Predicted pyridoxal phosphate-dependent 3e-06
COG3844407 COG3844, COG3844, Kynureninase [Amino acid transport an 4e-07
pfam00155351 pfam00155, Aminotran_1_2, Aminotransferase class I and 5e-07
cd00609350 cd00609, AAT_like, Aspartate aminotransferase family 1e-06
COG1921395 COG1921, SelA, Selenocysteine synthase [seryl-tRNASer s 1e-05
PRK04311464 PRK04311, PRK04311, selenocysteine synthase; Provisiona 3e-05
PRK05994427 PRK05994, PRK05994, O-acetylhomoserine aminocarboxyprop 3e-04
PRK08248431 PRK08248, PRK08248, O-acetylhomoserine aminocarboxyprop 6e-04
KOG0053409 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cy 0.002
TIGR02326363 TIGR02326, transamin_PhnW, 2-aminoethylphosphonate--pyr 0.004
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotran 1e-05
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotran 3e-05
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Provisi 3e-05
PRK05764393 PRK05764, PRK05764, aspartate aminotransferase; Provisi 3e-05
cd00614369 cd00614, CGS_like, CGS_like: Cystathionine gamma-syntha 1e-04
COG1003496 COG1003, GcvP, Glycine cleavage system protein P (pyrid 0.002
COG0626396 COG0626, MetC, Cystathionine beta-lyases/cystathionine 0.004
cd06502338 cd06502, TA_like, Low-specificity threonine aldolase (T 0.004
cd06454349 cd06454, KBL_like, KBL_like; this family belongs to the 2e-04
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA 2e-04
KOG2862385 KOG2862, KOG2862, KOG2862, Alanine-glyoxylate aminotran 7e-04
COG0156388 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and 0.004
>gnl|CDD|131034 TIGR01979, sufS, cysteine desulfurases, SufS subfamily Back     alignment and domain information
>gnl|CDD|30866 COG0520, CsdB, Selenocysteine lyase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178446 PLN02855, PLN02855, Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>gnl|CDD|181766 PRK09295, PRK09295, bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>gnl|CDD|144011 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|182799 PRK10874, PRK10874, cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>gnl|CDD|132433 TIGR03392, FeS_syn_CsdA, cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>gnl|CDD|131032 TIGR01977, am_tr_V_EF2568, cysteine desulfurase family protein Back     alignment and domain information
>gnl|CDD|36762 KOG1549, KOG1549, KOG1549, Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162635 TIGR01976, am_tr_V_VC1184, cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>gnl|CDD|31301 COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS Back     alignment and domain information
>gnl|CDD|132444 TIGR03403, nifS_epsilon, cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS Back     alignment and domain information
>gnl|CDD|178257 PLN02651, PLN02651, cysteine desulfurase Back     alignment and domain information
>gnl|CDD|184450 PRK14012, PRK14012, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|179511 PRK02948, PRK02948, cysteine desulfurase; Provisional Back     alignment and domain information
>gnl|CDD|99746 cd06453, SufS_like, Cysteine desulfurase (SufS)-like Back     alignment and domain information
>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA Back     alignment and domain information
>gnl|CDD|30425 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|31300 COG1103, COG1103, Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>gnl|CDD|162909 TIGR02539, SepCysS, Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|30424 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181402 PRK08363, PRK08363, alanine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|178031 PLN02409, PLN02409, serine--glyoxylate aminotransaminase Back     alignment and domain information
>gnl|CDD|99745 cd06452, SepCysS, Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>gnl|CDD|181782 PRK09331, PRK09331, Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|32700 COG2873, MET17, O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144590 pfam01053, Cys_Met_Meta_PP, Cys/Met metabolism PLP-dependent enzyme Back     alignment and domain information
>gnl|CDD|99740 cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>gnl|CDD|161897 TIGR00474, selA, seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>gnl|CDD|179178 PRK00950, PRK00950, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|112645 pfam03841, SelA, L-seryl-tRNA selenium transferase Back     alignment and domain information
>gnl|CDD|162303 TIGR01329, cysta_beta_ly_E, cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>gnl|CDD|144709 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|30748 COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|33635 COG3844, COG3844, Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|143923 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|32104 COG1921, SelA, Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179819 PRK04311, PRK04311, selenocysteine synthase; Provisional Back     alignment and domain information
>gnl|CDD|180344 PRK05994, PRK05994, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181321 PRK08248, PRK08248, O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>gnl|CDD|35276 KOG0053, KOG0053, KOG0053, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131379 TIGR02326, transamin_PhnW, 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>gnl|CDD|132344 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>gnl|CDD|30785 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180244 PRK05764, PRK05764, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|99738 cd00614, CGS_like, CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>gnl|CDD|31207 COG1003, GcvP, Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30971 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99748 cd06502, TA_like, Low-specificity threonine aldolase (TA) Back     alignment and domain information
>gnl|CDD|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>gnl|CDD|163524 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information
>gnl|CDD|38073 KOG2862, KOG2862, KOG2862, Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|30505 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 406 putative aminotransferase involved in iron-sulfur clust
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 100.0
PRK09295406 selenocysteine lyase; Validated 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 100.0
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 100.0
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 100.0
PRK02948381 cysteine desulfurase; Provisional 100.0
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 100.0
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 100.0
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 100.0
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 100.0
KOG1549428 consensus 100.0
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 100.0
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 100.0
COG3844407 Kynureninase [Amino acid transport and metabolism] 100.0
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 100.0
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 100.0
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 100.0
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 100.0
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 100.0
PRK06225375 aspartate aminotransferase; Provisional 99.97
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.97
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.96
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.96
KOG3846465 consensus 99.96
KOG2862385 consensus 99.96
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.96
PRK03566365 consensus 99.96
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 99.96
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.96
PRK09105374 putative aminotransferase; Provisional 99.96
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.96
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 99.96
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.96
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 99.96
PRK05764389 aspartate aminotransferase; Provisional 99.95
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.95
PRK08361390 aspartate aminotransferase; Provisional 99.94
PRK07367385 consensus 99.94
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.94
PRK08443388 consensus 99.94
PRK05957389 aspartate aminotransferase; Provisional 99.94
PRK03321352 putative aminotransferase; Provisional 99.94
PRK06836396 aspartate aminotransferase; Provisional 99.94
PRK06507400 consensus 99.94
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.94
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.94
PRK05794397 consensus 99.94
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.94
PRK06107402 aspartate aminotransferase; Provisional 99.93
PRK07212378 consensus 99.93
PRK07682378 hypothetical protein; Validated 99.93
PRK07310395 consensus 99.93
PRK05942394 aspartate aminotransferase; Provisional 99.93
PRK08362389 consensus 99.93
PRK06108382 aspartate aminotransferase; Provisional 99.93
PRK06056402 consensus 99.93
PRK03262355 consensus 99.93
PRK08069390 consensus 99.93
PRK07550387 hypothetical protein; Provisional 99.93
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.93
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.93
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.92
PRK10534333 L-threonine aldolase; Provisional 99.92
PRK07683387 aminotransferase A; Validated 99.92
PRK07179408 hypothetical protein; Provisional 99.92
PRK13393404 5-aminolevulinate synthase; Provisional 99.92
PRK04152364 consensus 99.92
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.92
PRK13392410 5-aminolevulinate synthase; Provisional 99.92
PRK09265404 aminotransferase AlaT; Validated 99.92
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.92
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 99.92
PRK07543400 consensus 99.92
PRK08068389 transaminase; Reviewed 99.92
PRK06348383 aspartate aminotransferase; Provisional 99.92
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.91
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.91
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.91
PRK06290411 aspartate aminotransferase; Provisional 99.91
PRK08912387 hypothetical protein; Provisional 99.91
PRK08363398 alanine aminotransferase; Validated 99.91
PRK06575399 consensus 99.91
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 99.91
PRK06375381 consensus 99.91
PRK07392358 threonine-phosphate decarboxylase; Validated 99.91
PRK07568396 aspartate aminotransferase; Provisional 99.91
PRK09064406 5-aminolevulinate synthase; Validated 99.91
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 99.91
PRK07681399 aspartate aminotransferase; Provisional 99.91
PRK08960387 hypothetical protein; Provisional 99.91
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.9
PRK13034422 serine hydroxymethyltransferase; Reviewed 99.9
PRK07777386 aminotransferase; Validated 99.9
PRK07908346 hypothetical protein; Provisional 99.9
PRK09276385 aspartate aminotransferase; Provisional 99.9
) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms . Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium and Gram-positive bacterium . A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01788">TIGR01788493 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR01 99.9
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 99.9
PRK07337388 aminotransferase; Validated 99.9
PRK12414384 putative aminotransferase; Provisional 99.9
PRK09148406 aminotransferase; Validated 99.9
PRK08636403 aspartate aminotransferase; Provisional 99.9
PRK09082386 putative aminotransferase; Validated 99.89
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 99.89
PRK08175395 aminotransferase; Validated 99.89
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 99.89
PRK07309390 aromatic amino acid aminotransferase; Validated 99.89
PTZ00094450 serine hydroxymethyltransferase; Provisional 99.89
PRK07778386 consensus 99.89
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 99.89
PRK09147397 aminotransferase; Provisional 99.89
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.88
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 99.88
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.88
PRK06220384 consensus 99.88
pfam00464380 SHMT Serine hydroxymethyltransferase. 99.87
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.87
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.87
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 99.87
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 99.86
PRK13580493 serine hydroxymethyltransferase; Provisional 99.86
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 99.86
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.85
PRK04366490 glycine dehydrogenase subunit 2; Validated 99.85
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 99.85
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.84
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 99.83
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 99.82
PTZ00125415 ornithine aminotransferase; Provisional 99.82
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 99.82
KOG1360570 consensus 99.82
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 99.82
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 99.82
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 99.82
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.81
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 99.81
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 99.81
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.81
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 99.81
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 99.81
PRK08466430 consensus 99.8
PRK08354312 putative aminotransferase; Provisional 99.8
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.8
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 99.8
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.8
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) family. 99.8
PRK05355360 phosphoserine aminotransferase; Provisional 99.8
PRK05839376 hypothetical protein; Provisional 99.8
PRK02627398 acetylornithine aminotransferase; Provisional 99.79
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.79
PRK09044418 consensus 99.79
PRK06855433 aminotransferase; Validated 99.79
PRK04260375 acetylornithine aminotransferase; Provisional 99.78
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.78
PRK12462364 phosphoserine aminotransferase; Provisional 99.78
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.77
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.77
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 99.77
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 99.76
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.76
PRK07678451 aminotransferase; Validated 99.76
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme metabolis 99.76
PRK08117429 4-aminobutyrate aminotransferase; Provisional 99.76
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.75
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.75
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 99.75
PRK07495422 4-aminobutyrate aminotransferase; Provisional 99.75
PRK07894430 consensus 99.75
PRK061481015 hypothetical protein; Provisional 99.74
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.74
PRK06105460 aminotransferase; Provisional 99.74
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 99.74
PRK08088426 4-aminobutyrate aminotransferase; Validated 99.74
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.73
PRK06541460 hypothetical protein; Provisional 99.73
PRK07481448 hypothetical protein; Provisional 99.73
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.73
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 99.73
PRK06058446 4-aminobutyrate aminotransferase; Provisional 99.72
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 99.72
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.72
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.72
KOG1357519 consensus 99.72
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 99.71
PRK08593448 4-aminobutyrate aminotransferase; Provisional 99.71
PRK04311465 selenocysteine synthase; Provisional 99.71
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.7
PRK05965459 hypothetical protein; Provisional 99.7
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.7
PRK06062434 hypothetical protein; Provisional 99.7
PRK07482461 hypothetical protein; Provisional 99.7
PRK06917447 hypothetical protein; Provisional 99.7
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.69
PRK07036466 hypothetical protein; Provisional 99.69
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 99.69
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 99.69
PRK07323443 consensus 99.69
PRK06149972 hypothetical protein; Provisional 99.69
PRK06082460 4-aminobutyrate aminotransferase; Provisional 99.68
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 99.68
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.68
PRK07480459 putative aminotransferase; Validated 99.68
PRK05769442 4-aminobutyrate aminotransferase; Provisional 99.67
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 99.67
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 99.67
KOG1359417 consensus 99.67
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 99.67
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.66
KOG0259447 consensus 99.66
PRK08637386 hypothetical protein; Provisional 99.66
PRK07483443 hypothetical protein; Provisional 99.66
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 99.65
PRK08555443 consensus 99.65
PRK08297449 L-lysine aminotransferase; Provisional 99.64
PRK07046452 aminotransferase; Validated 99.62
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.62
KOG2467477 consensus 99.6
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 99.6
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 99.59
PRK12403460 putative aminotransferase; Provisional 99.58
TIGR01364391 serC_1 phosphoserine aminotransferase; InterPro: IPR003 99.57
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 99.55
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 99.54
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 99.54
TIGR00474448 selA L-seryl-tRNA selenium transferase; InterPro: IPR00 99.43
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.42
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 99.39
KOG2142 728 consensus 99.34
PRK09257397 aromatic amino acid aminotransferase; Provisional 99.31
KOG1404442 consensus 99.26
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 99.22
KOG1402427 consensus 99.11
KOG2790370 consensus 99.07
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 99.02
KOG1401433 consensus 99.0
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 98.89
PRK13237459 tyrosine phenol-lyase; Provisional 98.86
PRK13238461 tnaA tryptophanase; Provisional 98.78
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 98.65
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 98.39
KOG1403452 consensus 98.39
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 98.32
KOG1411427 consensus 95.72
PRK13520375 L-tyrosine decarboxylase; Provisional 100.0
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.96
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 99.94
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 99.93
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.93
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.93
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 99.92
PRK06207406 aspartate aminotransferase; Provisional 99.92
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.92
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.92
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.92
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.92
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 99.91
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 99.91
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.91
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 99.9
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.87
PRK07505405 hypothetical protein; Provisional 99.84
PRK03080381 phosphoserine aminotransferase; Provisional 99.76
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 99.75
TIGR01329415 cysta_beta_ly_E cystathionine beta-lyase; InterPro: IPR 99.74
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase; Int 99.67
PRK12566954 glycine dehydrogenase; Provisional 99.63
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 99.26
KOG0258475 consensus 98.85
KOG1358467 consensus 98.77
TIGR00700427 GABAtrnsam 4-aminobutyrate transaminase; InterPro: IPR0 98.14
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.96
PRK09275531 aspartate aminotransferase; Provisional 98.57
KOG3843432 consensus 92.0
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 99.95
PRK02769380 histidine decarboxylase; Provisional 99.94
PRK07324373 transaminase; Validated 99.93
PRK07503403 methionine gamma-lyase; Provisional 99.92
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.92
PRK08249398 cystathionine gamma-synthase; Provisional 99.91
PRK06234399 methionine gamma-lyase; Provisional 99.91
PRK00451449 glycine dehydrogenase subunit 1; Validated 99.91
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.9
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.9
PRK09028394 cystathionine beta-lyase; Provisional 99.9
PRK06767386 methionine gamma-lyase; Provisional 99.9
PRK05968389 hypothetical protein; Provisional 99.9
PRK05967392 cystathionine beta-lyase; Provisional 99.9
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.9
PRK08776405 cystathionine gamma-synthase; Provisional 99.9
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.9
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.9
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.9
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.89
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.89
PRK07811386 cystathionine gamma-synthase; Provisional 99.89
PRK08045386 cystathionine gamma-synthase; Provisional 99.89
PRK08064390 cystathionine beta-lyase; Provisional 99.89
PRK08861388 cystathionine gamma-synthase; Provisional 99.89
PRK06460375 hypothetical protein; Provisional 99.89
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.89
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 99.89
PRK08247366 cystathionine gamma-synthase; Reviewed 99.88
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.88
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.88
PRK08114395 cystathionine beta-lyase; Provisional 99.88
PRK05939396 hypothetical protein; Provisional 99.88
PRK07671377 cystathionine beta-lyase; Provisional 99.88
PRK07050394 cystathionine beta-lyase; Provisional 99.87
PRK08574384 cystathionine gamma-synthase; Provisional 99.86
PRK07582370 cystathionine gamma-lyase; Validated 99.85
PRK07049427 methionine gamma-lyase; Validated 99.85
KOG1383491 consensus 99.84
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 99.84
PRK07269364 cystathionine gamma-synthase; Reviewed 99.82
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.81
KOG1368384 consensus 99.81
PRK06434384 cystathionine gamma-lyase; Validated 99.8
KOG0053409 consensus 99.78
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 99.75
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 99.72
PRK05367955 glycine dehydrogenase; Provisional 99.69
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 99.68
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 99.65
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Amino ac 99.61
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 99.58
PRK13578 720 ornithine decarboxylase; Provisional 99.55
TIGR01324389 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR 99.55
KOG0629510 consensus 99.51
PRK05367 955 glycine dehydrogenase; Provisional 99.43
PRK12566 954 glycine dehydrogenase; Provisional 99.39
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 99.29
KOG20401001 consensus 99.28
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 99.13
KOG0256471 consensus 99.11
TIGR01366362 serC_3 phosphoserine aminotransferase, putative; InterP 99.04
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 99.01
KOG0633375 consensus 98.88
KOG2040 1001 consensus 98.71
TIGR00461 965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 98.56
TIGR01365379 serC_2 phosphoserine aminotransferase; InterPro: IPR006 98.43
pfam04864363 Alliinase_C Allinase. Allicin is a thiosulphinate that 98.04
KOG1412410 consensus 97.28
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 99.95
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 99.89
pfam03841367 SelA L-seryl-tRNA selenium transferase. 99.71
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 99.83
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 99.79
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.77
KOG0257420 consensus 99.68
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 99.59
pfam00202338 Aminotran_3 Aminotransferase class-III. 99.27
KOG0628511 consensus 99.46
pfam06838405 Alum_res Aluminium resistance protein. This family repr 99.15
COG4100416 Cystathionine beta-lyase family protein involved in alu 98.74
KOG0634472 consensus 98.69
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 98.66
TIGR00699469 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro 97.99
KOG1405484 consensus 97.45
pfam04309174 G3P_antiterm Glycerol-3-phosphate responsive antitermin 92.68
>TIGR01979 sufS cysteine desulfurases, SufS subfamily; InterPro: IPR010970 Cysteine desulphurases are pyridoxal-phosphate enzymes which catalyse the removal of sulphur from L-cysteine to form L-alanine and elemental sulphur Back     alignment and domain information
>PRK09295 selenocysteine lyase; Validated Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein; InterPro: IPR010969 This entry describes a subfamily of probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family Back     alignment and domain information
>pfam00266 Aminotran_5 Aminotransferase class-V Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein; InterPro: IPR011340 This entry describes probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>KOG1549 consensus Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS; InterPro: IPR010240 This entry represents cysteine deusulphurase (IscS), one of several cysteine desulphurases from a larger protein family designated (misleadingly, in this case) class V aminotransferases Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01814 kynureninase kynureninase; InterPro: IPR010111 This entry describes kynureninase, it is a pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes the hydrolytic cleavage of L-kynurenine to anthranilic acid and L-alanine Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>KOG3846 consensus Back     alignment and domain information
>KOG2862 consensus Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03566 consensus Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase; InterPro: IPR010961 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway Back     alignment and domain information