254781063

254781063

hypothetical protein CLIBASIA_04825

GeneID in NCBI database:8210086Locus tag:CLIBASIA_04825
Protein GI in NCBI database:254781063Protein Accession:YP_003065476.1
Gene range:+(1067528, 1067917)Protein Length:129aa
Gene description:hypothetical protein
COG prediction:[R] Predicted metal-sulfur cluster biosynthetic enzyme
KEGG prediction:hypothetical protein
SEED prediction:PaaD-like protein (DUF59) involved in Fe-S cluster assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEcccEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHccHHHHHHHccc
ccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEccEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHccHHHHHHHccc
mkqknpdtenniadkialspestippedleRISNDIIAALKtvydpeipcdifeLGLIYKIDVENDYMVKILMTLtapgcpvagdmpKWIENAVGAVegisgvevsitfdppwtpdlmseEAQIATGYY
mkqknpdtenniadkialspestippedLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITfdppwtpdlmSEEAQIATGYY
MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
*********************************NDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
*********NNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEE********
*********************STIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIA*G*Y
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
MKQKNPDTENNIADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
315122403129 hypothetical protein CKC_03275 [Candidatus Liberibacter 1 2e-55
325293222127 FeS assembly SUF system protein [Agrobacterium sp. H13- 1 5e-46
307302605126 FeS assembly SUF system protein [Sinorhizobium meliloti 1 6e-46
15965484126 hypothetical protein SMc00302 [Sinorhizobium meliloti 1 1 6e-46
159184933127 hypothetical protein Atu1820 [Agrobacterium tumefaciens 1 1e-45
116252323126 hypothetical protein RL2577 [Rhizobium leguminosarum bv 1 2e-45
227822095126 putative FeS assembly protein [Sinorhizobium fredii NGR 1 2e-45
150396677126 FeS assembly SUF system protein [Sinorhizobium medicae 1 3e-45
209549489126 FeS assembly SUF system protein [Rhizobium leguminosaru 1 3e-45
86357863126 hypothetical protein RHE_CH02248 [Rhizobium etli CFN 42 1 3e-45
>gi|315122403|ref|YP_004062892.1| hypothetical protein CKC_03275 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129 Back     alignment and organism information
 Score =  218 bits (554), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (95%)

Query: 12  IADKIALSPESTIPPEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKI 71
           ++D + ++ ES+IPPE+LERISNDIIAALKTVYDPEIPCDIFELGLIYK+DVE+DYMVKI
Sbjct: 12  VSDTVQVTAESSIPPEELERISNDIIAALKTVYDPEIPCDIFELGLIYKVDVEDDYMVKI 71

Query: 72  LMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY 129
           LMTLTAP CPVAGDMPKWIENAVG VEGISGVEVSITFDPPWTPDLMSEEAQIATGYY
Sbjct: 72  LMTLTAPACPVAGDMPKWIENAVGTVEGISGVEVSITFDPPWTPDLMSEEAQIATGYY 129


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293222|ref|YP_004279086.1| FeS assembly SUF system protein [Agrobacterium sp. H13-3] Length = 127 Back     alignment and organism information
>gi|307302605|ref|ZP_07582361.1| FeS assembly SUF system protein [Sinorhizobium meliloti BL225C] Length = 126 Back     alignment and organism information
>gi|15965484|ref|NP_385837.1| hypothetical protein SMc00302 [Sinorhizobium meliloti 1021] Length = 126 Back     alignment and organism information
>gi|159184933|ref|NP_354804.2| hypothetical protein Atu1820 [Agrobacterium tumefaciens str. C58] Length = 127 Back     alignment and organism information
>gi|116252323|ref|YP_768161.1| hypothetical protein RL2577 [Rhizobium leguminosarum bv. viciae 3841] Length = 126 Back     alignment and organism information
>gi|227822095|ref|YP_002826066.1| putative FeS assembly protein [Sinorhizobium fredii NGR234] Length = 126 Back     alignment and organism information
>gi|150396677|ref|YP_001327144.1| FeS assembly SUF system protein [Sinorhizobium medicae WSM419] Length = 126 Back     alignment and organism information
>gi|209549489|ref|YP_002281406.1| FeS assembly SUF system protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 126 Back     alignment and organism information
>gi|86357863|ref|YP_469755.1| hypothetical protein RHE_CH02248 [Rhizobium etli CFN 42] Length = 126 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
TIGR0294599 TIGR02945, SUF_assoc, FeS assembly SUF system protein 3e-38
TIGR03406174 TIGR03406, FeS_long_SufT, probable FeS assembly SUF sys 9e-24
pfam0188376 pfam01883, DUF59, Domain of unknown function DUF59 7e-20
TIGR02159146 TIGR02159, PA_CoA_Oxy4, phenylacetate-CoA oxygenase, Pa 1e-09
COG2151111 COG2151, PaaD, Predicted metal-sulfur cluster biosynthe 2e-28
>gnl|CDD|131990 TIGR02945, SUF_assoc, FeS assembly SUF system protein Back     alignment and domain information
>gnl|CDD|132447 TIGR03406, FeS_long_SufT, probable FeS assembly SUF system protein SufT Back     alignment and domain information
>gnl|CDD|110847 pfam01883, DUF59, Domain of unknown function DUF59 Back     alignment and domain information
>gnl|CDD|131214 TIGR02159, PA_CoA_Oxy4, phenylacetate-CoA oxygenase, PaaJ subunit Back     alignment and domain information
>gnl|CDD|32334 COG2151, PaaD, Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
TIGR0294596 SUF_assoc FeS assembly SUF system protein; InterPro: IP 100.0
TIGR03406174 FeS_long_SufT probable FeS assembly SUF system protein 100.0
COG2151111 PaaD Predicted metal-sulfur cluster biosynthetic enzyme 99.98
TIGR02159152 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; 99.92
pfam0188376 DUF59 Domain of unknown function DUF59. This family inc 99.89
PRK11670 369 putative ATPase; Provisional 99.65
COG5133181 Uncharacterized conserved protein [Function unknown] 96.94
TIGR03341190 YhgI_GntY IscR-regulated protein YhgI. IscR (TIGR02010) 94.15
KOG3381161 consensus 98.21
>TIGR02945 SUF_assoc FeS assembly SUF system protein; InterPro: IPR014291 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR03406 FeS_long_SufT probable FeS assembly SUF system protein SufT Back     alignment and domain information
>COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] Back     alignment and domain information
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; InterPro: IPR011883 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information
>pfam01883 DUF59 Domain of unknown function DUF59 Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>COG5133 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03341 YhgI_GntY IscR-regulated protein YhgI Back     alignment and domain information
>KOG3381 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
1uwd_A103 Nmr Structure Of A Protein With Unknown Function Fr 7e-25
3lno_A108 Crystal Structure Of Domain Of Unknown Function Duf 3e-20
2cu6_A103 Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Red 1e-18
3cq1_A103 Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase R 2e-18
>gi|58176957|pdb|1UWD|A Chain A, Nmr Structure Of A Protein With Unknown Function From Thermotoga Maritima (Tm0487), Which Belongs To The Duf59 Family. Length = 103 Back     alignment and structure
 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 64/102 (62%)

Query: 26  PEDLERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGD 85
           P   +    D++ ALK V D E+  D+  LGL+Y I +++   VK+LMT+T P CP+AG 
Sbjct: 1   PMSKKVTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGM 60

Query: 86  MPKWIENAVGAVEGISGVEVSITFDPPWTPDLMSEEAQIATG 127
           +    E A+  +EG++ VEV +TFDPPWTP+ MS E +   G
Sbjct: 61  ILSDAEEAIKKIEGVNNVEVELTFDPPWTPERMSPELREKFG 102


>gi|288965879|pdb|3LNO|A Chain A, Crystal Structure Of Domain Of Unknown Function Duf59 From Bacillus Anthracis Length = 108 Back     alignment and structure
>gi|83754864|pdb|2CU6|A Chain A, Crystal Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase- Related Protein From Thermus Thermophilus Hb8 Length = 103 Back     alignment and structure
>gi|226438173|pdb|3CQ1|A Chain A, Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase Related Protein (Tt1362) From Thermus Thermophilus Hb8 Length = 103 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
3lno_A108 Putative uncharacterized protein; alpha-beta fold, stru 2e-27
1uwd_A103 Hypothetical protein TM0487; structural genomics, unkno 3e-26
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-keto-L 3e-26
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Length = 108 Back     alignment and structure
 Score =  116 bits (292), Expect = 2e-27
 Identities = 35/99 (35%), Positives = 59/99 (59%), Gaps = 1/99 (1%)

Query: 30  ERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKW 89
           E   N + A L+ V DPE+  DI  LGL+Y +  + +    I MT+T+ GCP+AG +   
Sbjct: 7   EAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSD 66

Query: 90  IENAVG-AVEGISGVEVSITFDPPWTPDLMSEEAQIATG 127
           ++  +   V  ++ +EV++ ++PPW+ + MS  A+IA G
Sbjct: 67  VKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALG 105


>1uwd_A Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A Length = 103 Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Length = 103 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
3lno_A108 Putative uncharacterized protein; alpha-beta fold, stru 100.0
1uwd_A103 Hypothetical protein TM0487; structural genomics, unkno 99.98
3cq1_A103 Putative uncharacterized protein TTHB138; DTDP-4-keto-L 99.97
1veh_A92 NIFU-like protein hirip5; structural genomics, mouse cD 91.27
1xhj_A88 Nitrogen fixation protein NIFU; alpha-beta, NIFU-like, 92.26
>3lno_A Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Back     alignment and structure
Probab=100.00  E-value=6.4e-34  Score=223.44  Aligned_cols=101  Identities=35%  Similarity=0.672  Sum_probs=96.7

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEECCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHHHHH-CCCCCCEEEEEE
Q ss_conf             3589999999972088888998433204013215603996999999658988517899999999997-099866169999
Q gi|254781063|r   29 LERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVG-AVEGISGVEVSI  107 (129)
Q Consensus        29 ~~~l~~~V~eaL~~V~DPEl~v~IvdLGlV~~i~i~~~g~V~V~l~lT~~~CP~~~~i~~~i~~al~-~~~gv~~V~V~~  107 (129)
                      .+.++++|+++|++|+|||+|+|||+|||||+|.++++|+|.|.|+||+++||+++.|.++|++++. +++||.+|+|++
T Consensus         6 ~e~~e~~I~~aL~~V~DPEl~v~IvdLGLV~~i~v~~~~~v~V~m~lT~~~CP~~~~i~~~i~~~l~~~l~gv~~v~V~~   85 (108)
T 3lno_A            6 QEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNV   85 (108)
T ss_dssp             HHHHHHHHHHHGGGCEETTTTEEHHHHTCEEEEEECTTCCEEEEECCSCTTCTTHHHHHHHHHHHHHHHCTTCCCEEEEE
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCEECCCCEEEEEECCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             78999999999817779999976331682788886379659999951878998089999999999996499985499999


Q ss_pred             EECCCCCCCCCCHHHHHHCCCC
Q ss_conf             9778898330698999960799
Q gi|254781063|r  108 TFDPPWTPDLMSEEAQIATGYY  129 (129)
Q Consensus       108 ~~~p~W~~~~is~~~r~~lG~~  129 (129)
                      +|+|+|+++|||++||.+||++
T Consensus        86 ~~~p~Wt~~~ms~~ar~~LGi~  107 (108)
T 3lno_A           86 VWNPPWSKERMSRMAKIALGIR  107 (108)
T ss_dssp             CCSSCCCGGGSCHHHHHHHHHC
T ss_pred             EECCCCCHHHCCHHHHHHCCCC
T ss_conf             9679999466809999985899



>1uwd_A Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} SCOP: d.52.8.2 PDB: 1wcj_A Back     alignment and structure
>3cq1_A Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
>1veh_A NIFU-like protein hirip5; structural genomics, mouse cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.52.8.1 Back     alignment and structure
>1xhj_A Nitrogen fixation protein NIFU; alpha-beta, NIFU-like, structural genomics, protein structure initiative, NESG, PSI; NMR {Staphylococcus epidermidis atcc 12228} SCOP: d.52.8.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
d1uwda_102 d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga m 1e-26
d2cu6a191 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus 2e-23
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Length = 102 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Fe-S cluster assembly (FSCA) domain-like
family: PaaD-like
domain: Hypothetical protein TM0487
species: Thermotoga maritima [TaxId: 2336]
 Score =  111 bits (280), Expect = 1e-26
 Identities = 43/94 (45%), Positives = 62/94 (65%)

Query: 34  NDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENA 93
            D++ ALK V D E+  D+  LGL+Y I +++   VK+LMT+T P CP+AG +    E A
Sbjct: 8   EDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEA 67

Query: 94  VGAVEGISGVEVSITFDPPWTPDLMSEEAQIATG 127
           +  +EG++ VEV +TFDPPWTP+ MS E +   G
Sbjct: 68  IKKIEGVNNVEVELTFDPPWTPERMSPELREKFG 101


>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Length = 91 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
d1uwda_102 Hypothetical protein TM0487 {Thermotoga maritima [TaxId 99.97
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus [Tax 99.95
d1veha_92 HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus 95.05
d1xhja_88 Nitrogen fixation protein NifU homolog SE0630 {Staphylo 91.6
>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Fe-S cluster assembly (FSCA) domain-like
family: PaaD-like
domain: Hypothetical protein TM0487
species: Thermotoga maritima [TaxId: 2336]
Probab=99.97  E-value=1e-31  Score=208.79  Aligned_cols=98  Identities=44%  Similarity=0.767  Sum_probs=94.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCEEEECCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEEC
Q ss_conf             89999999972088888998433204013215603996999999658988517899999999997099866169999977
Q gi|254781063|r   31 RISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSITFD  110 (129)
Q Consensus        31 ~l~~~V~eaL~~V~DPEl~v~IvdLGlV~~i~i~~~g~V~V~l~lT~~~CP~~~~i~~~i~~al~~~~gv~~V~V~~~~~  110 (129)
                      ..+++|+++|++|+|||+|+|||+|||||+|.|+++|.|.|.|+||+++||+.+.|.+++++++++++||.+|+|+++|+
T Consensus         5 vt~~~V~~aL~~V~DPe~~~dIV~LGlV~~i~I~~~g~V~v~~~lt~~~Cp~~~~i~~~i~~al~~~~gV~~v~V~i~~~   84 (102)
T d1uwda_           5 VTKEDVLNALKNVIDFELGLDVVSLGLVYDIQIDDQNNVKVLMTMTTPMCPLAGMILSDAEEAIKKIEGVNNVEVELTFD   84 (102)
T ss_dssp             CCHHHHHHHHTTCBCTTTSSBTTTTTCCCCEEECTTCEEEEEECCSSSCCSSHHHHHHHHHHHHHTSSSCCEEEEEECCS
T ss_pred             CCHHHHHHHHHCCCCCCCCCCEEECCCEEEEEECCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEEC
T ss_conf             59999999981788999992614436235677514664278886488999627999999999998289976089999962


Q ss_pred             CCCCCCCCCHHHHHHCCC
Q ss_conf             889833069899996079
Q gi|254781063|r  111 PPWTPDLMSEEAQIATGY  128 (129)
Q Consensus       111 p~W~~~~is~~~r~~lG~  128 (129)
                      |||+|+|||++||.+||+
T Consensus        85 p~W~~~~~s~~~r~~lG~  102 (102)
T d1uwda_          85 PPWTPERMSPELREKFGV  102 (102)
T ss_dssp             SCCCGGGSCHHHHHHHTC
T ss_pred             CCCCHHHCCHHHHHHCCC
T ss_conf             999937778999998579



>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 hypothetical protein CLIBASIA_04825 [Candidatus Li
3cq1_A_103 (A:) Putative uncharacterized protein TTHB138; DTD 9e-26
1uwd_A_1-8888 (A:1-88) Hypothetical protein TM0487; structural g 2e-22
3lno_A_1-9292 (A:1-92) Putative uncharacterized protein; alpha-b 2e-21
>3cq1_A (A:) Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A*Length = 103 Back     alignment and structure
 Score =  110 bits (276), Expect = 9e-26
 Identities = 37/94 (39%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 35  DIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAV 94
              A L+ VYDPE+  D+  LGLIY + VE      +  TLT PGCP+   + + +  A+
Sbjct: 10  QAWALLEAVYDPELGLDVVNLGLIYDLVVEPP-RAYVRXTLTTPGCPLHDSLGEAVRQAL 68

Query: 95  GAVEGISGVEVSITFDPPWTPDLMSEEAQIATGY 128
             + G+  VEV +TF+PPWT   +SE+A+   G+
Sbjct: 69  SRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102


>1uwd_A (A:1-88) Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima}Length = 88 Back     alignment and structure
>3lno_A (A:1-92) Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis}Length = 92 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 hypothetical protein CLIBASIA_04825 [Candidatus Liberib
3cq1_A_103 Putative uncharacterized protein TTHB138; DTDP-4-k 99.94
3lno_A_1-9292 Putative uncharacterized protein; alpha-beta fold, 99.88
1uwd_A_1-8888 Hypothetical protein TM0487; structural genomics, 99.86
>3cq1_A (A:) Putative uncharacterized protein TTHB138; DTDP-4-keto-L-rhamnose reductase, plasmid, oxidoreductase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2cu6_A 3cq2_A 3cq3_A* Back     alignment and structure
Probab=99.94  E-value=5.2e-27  Score=182.84  Aligned_cols=99  Identities=37%  Similarity=0.684  Sum_probs=95.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCEEEECCEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             35899999999720888889984332040132156039969999996589885178999999999970998661699999
Q gi|254781063|r   29 LERISNDIIAALKTVYDPEIPCDIFELGLIYKIDVENDYMVKILMTLTAPGCPVAGDMPKWIENAVGAVEGISGVEVSIT  108 (129)
Q Consensus        29 ~~~l~~~V~eaL~~V~DPEl~v~IvdLGlV~~i~i~~~g~V~V~l~lT~~~CP~~~~i~~~i~~al~~~~gv~~V~V~~~  108 (129)
                      ...++++|+++|++|.||++++|||+||||++|.++ ++.|.|.|++|+++||+.+.|.++|++++++++|+.+|+|+++
T Consensus         4 ~~~~~~~i~~aL~~V~DP~~~~~Iv~lg~V~~i~i~-~~~V~v~l~l~~~~~~~~~~i~~~i~~~l~~l~gv~~V~V~~~   82 (103)
T 3cq1_A            4 RNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVE-PPRAYVRXTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVT   82 (103)
T ss_dssp             CSHHHHHHHHHHTTCBCTTTCSBTTTTTCEEEEEEE-TTEEEEEECCSSSSCCSSCHHHHHHHHHHHTSTTCCEEEEEEC
T ss_pred             CCHHHHHHHHHHCCCCCCCCCCCHHHCCCCEEEEEE-CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEE
T ss_conf             837899999998168898999884445772157886-5835728807999986789999999999981899750899999


Q ss_pred             ECCCCCCCCCCHHHHHHCCC
Q ss_conf             77889833069899996079
Q gi|254781063|r  109 FDPPWTPDLMSEEAQIATGY  128 (129)
Q Consensus       109 ~~p~W~~~~is~~~r~~lG~  128 (129)
                      |+|+|+++|||+++|.+|||
T Consensus        83 ~~~~~~~~~~~~~~r~~lg~  102 (103)
T 3cq1_A           83 FEPPWTLARLSEKARRLLGW  102 (103)
T ss_dssp             CSSCCCGGGCCSGGGTTTC-
T ss_pred             ECCCCCHHHCCHHHHHHCCC
T ss_conf             66999957775999997289



>3lno_A (A:1-92) Putative uncharacterized protein; alpha-beta fold, structural genomics, center for structural genomics of infectious diseases, csgid; 2.10A {Bacillus anthracis} Back     alignment and structure
>1uwd_A (A:1-88) Hypothetical protein TM0487; structural genomics, unknown function, contains PAAD domain, similar to PAAD protein, unknown activity; NMR {Thermotoga maritima} Back     alignment and structure