254781064

254781064

FeS assembly scaffold SufA

GeneID in NCBI database:8210087Locus tag:CLIBASIA_04830
Protein GI in NCBI database:254781064Protein Accession:YP_003065477.1
Gene range:+(1067993, 1068343)Protein Length:116aa
Gene description:FeS assembly scaffold SufA
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:FeS assembly scaffold SufA; K13628 iron-sulfur cluster assembly protein
SEED prediction:Iron binding protein SufA for iron-sulfur cluster assembly
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Fe-S cluster assembly
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
ccccEEEcHHHHHHHHHHHHHccccccEEEEEEEccccccEEEEEEEcccccccccEEEEccccEEEEcHHHHHHHcccEEEEEEcccccEEEEEccccccccccccEEEEccccc
ccccEEccHHHHHHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEcccccccccEEEcccEEEEEccccHHHHcccEEEEEEcccccEEEEEcccccccccccccEEEccccc
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVtdnpvdgddliekdgVKVWIDSASLLYMLGTeidfkteklysgfvfhnpnqvsacgcgqsveikradl
MSDIVTMTEAAVYRIKEivfnsqgkaqgiRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPnqvsacgcgqsveikradl
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
**DIVTMTEAAVYRIKEIV***QG*AQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK*A**
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
*SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL
MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
254780287109 iron-sulfur cluster assembly accessory protein [Ca 8e-19
>gi|254780287|ref|YP_003064700.1| iron-sulfur cluster assembly accessory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 109 Back     alignment
 Score = 84.0 bits (206), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M  I+ +T+AA  +IK I+  S    + +RI+++ GGC+G  Y  DL +    D D + E
Sbjct: 1   MVPIIKITDAAATQIKTIL-ESNSDKKALRITIEGGGCSGFSYKFDLESKQSED-DIVFE 58

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K+G +++ID  SL Y+  +EIDF    L   F   NPN  S CGCG S  I
Sbjct: 59  KNGAQIFIDKISLAYLTNSEIDFVDNLLSKSFQIRNPNATSNCGCGTSFSI 109

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
315122404129 FeS assembly scaffold SufA [Candidatus Liberibacter sol 1 3e-49
222148795128 FeS assembly scaffold SufA [Agrobacterium vitis S4] Len 1 3e-36
150396676130 FeS assembly scaffold SufA [Sinorhizobium medicae WSM41 1 3e-35
15965483130 hypothetical protein SMc00301 [Sinorhizobium meliloti 1 1 5e-35
241204821130 FeS assembly scaffold SufA [Rhizobium leguminosarum bv. 1 3e-34
327191052130 FeS assembly scaffold SufA [Rhizobium etli CNPAF512] Le 1 3e-34
116252322130 HesB nitrogen fixation family protein [Rhizobium legumi 1 3e-34
209549488130 FeS assembly scaffold SufA [Rhizobium leguminosarum bv. 1 1e-33
218463662130 FeS assembly scaffold SufA [Rhizobium etli Kim 5] Lengt 1 1e-33
218672061130 FeS assembly scaffold SufA [Rhizobium etli GR56] Length 1 1e-33
>gi|315122404|ref|YP_004062893.1| FeS assembly scaffold SufA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129 Back     alignment and organism information
 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 95/115 (82%), Positives = 106/115 (92%), Gaps = 1/115 (0%)

Query: 2   SDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +D+VTMTEAAV R+K+IV NSQG AQGIRISLKKGGCAGLEYMVDLVT+ P + DDL+EK
Sbjct: 4   NDVVTMTEAAVSRVKDIVKNSQGTAQGIRISLKKGGCAGLEYMVDLVTE-PFNEDDLVEK 62

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRADL 116
           DGVKVWID ++LLY+LG EIDFK EKL+SGFVFHNPNQVSACGCGQSVEIKRADL
Sbjct: 63  DGVKVWIDPSALLYILGMEIDFKIEKLHSGFVFHNPNQVSACGCGQSVEIKRADL 117


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148795|ref|YP_002549752.1| FeS assembly scaffold SufA [Agrobacterium vitis S4] Length = 128 Back     alignment and organism information
>gi|150396676|ref|YP_001327143.1| FeS assembly scaffold SufA [Sinorhizobium medicae WSM419] Length = 130 Back     alignment and organism information
>gi|15965483|ref|NP_385836.1| hypothetical protein SMc00301 [Sinorhizobium meliloti 1021] Length = 130 Back     alignment and organism information
>gi|241204821|ref|YP_002975917.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 130 Back     alignment and organism information
>gi|327191052|gb|EGE58105.1| FeS assembly scaffold SufA [Rhizobium etli CNPAF512] Length = 130 Back     alignment and organism information
>gi|116252322|ref|YP_768160.1| HesB nitrogen fixation family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 130 Back     alignment and organism information
>gi|209549488|ref|YP_002281405.1| FeS assembly scaffold SufA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 130 Back     alignment and organism information
>gi|218463662|ref|ZP_03503753.1| FeS assembly scaffold SufA [Rhizobium etli Kim 5] Length = 130 Back     alignment and organism information
>gi|218672061|ref|ZP_03521730.1| FeS assembly scaffold SufA [Rhizobium etli GR56] Length = 130 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
TIGR01997107 TIGR01997, sufA_proteo, FeS assembly scaffold SufA 2e-34
TIGR00049105 TIGR00049, TIGR00049, Iron-sulfur cluster assembly acce 8e-30
KOG1120134 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis pr 3e-23
TIGR02011105 TIGR02011, IscA, iron-sulfur cluster assembly protein I 3e-21
pfam0152191 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthes 9e-21
PRK09502107 PRK09502, iscA, iron-sulfur cluster assembly protein; P 5e-20
PRK09504122 PRK09504, sufA, iron-sulfur cluster assembly scaffold p 4e-19
KOG1119199 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster b 6e-17
PRK13623115 PRK13623, PRK13623, iron-sulfur cluster insertion prote 5e-15
PLN03082163 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provi 6e-14
TIGR03341190 TIGR03341, YhgI_GntY, IscR-regulated protein YhgI 4e-04
COG0316110 COG0316, IscA, Uncharacterized conserved protein [Funct 7e-32
>gnl|CDD|131052 TIGR01997, sufA_proteo, FeS assembly scaffold SufA Back     alignment and domain information
>gnl|CDD|161681 TIGR00049, TIGR00049, Iron-sulfur cluster assembly accessory protein Back     alignment and domain information
>gnl|CDD|36336 KOG1120, KOG1120, KOG1120, Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131066 TIGR02011, IscA, iron-sulfur cluster assembly protein IscA Back     alignment and domain information
>gnl|CDD|110518 pfam01521, Fe-S_biosyn, Iron-sulphur cluster biosynthesis Back     alignment and domain information
>gnl|CDD|181914 PRK09502, iscA, iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>gnl|CDD|181915 PRK09504, sufA, iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>gnl|CDD|36335 KOG1119, KOG1119, KOG1119, Mitochondrial Fe-S cluster biosynthesis protein ISA2 (contains a HesB-like domain) [Energy production and conversion, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|184186 PRK13623, PRK13623, iron-sulfur cluster insertion protein ErpA; Provisional Back     alignment and domain information
>gnl|CDD|178631 PLN03082, PLN03082, Iron-sulfur cluster assembly; Provisional Back     alignment and domain information
>gnl|CDD|132384 TIGR03341, YhgI_GntY, IscR-regulated protein YhgI Back     alignment and domain information
>gnl|CDD|30664 COG0316, IscA, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
TIGR00049105 TIGR00049 iron-sulfur cluster assembly accessory protei 100.0
PRK13623118 iron-sulfur cluster insertion protein ErpA; Provisional 100.0
PRK09502107 iscA iron-sulfur cluster assembly protein; Provisional 100.0
COG0316110 sufA Fe-S cluster assembly scaffold protein [Posttransl 100.0
PRK09504122 sufA iron-sulfur cluster assembly scaffold protein; Pro 100.0
TIGR01997110 sufA_proteo FeS assembly scaffold SufA; InterPro: IPR01 100.0
KOG1120134 consensus 100.0
PRK11190192 putative DNA uptake protein; Provisional 99.96
TIGR03341190 YhgI_GntY IscR-regulated protein YhgI. IscR (TIGR02010) 99.96
TIGR02011105 IscA iron-sulfur cluster assembly protein IscA; InterPr 99.96
KOG1119199 consensus 99.95
pfam0152191 Fe-S_biosyn Iron-sulphur cluster biosynthesis. This fam 99.95
TIGR0191193 HesB_rel_seleno HesB-related (seleno)protein; InterPro: 98.89
COG484195 Uncharacterized protein conserved in bacteria [Function 98.13
COG3564116 Uncharacterized protein conserved in bacteria [Function 95.27
pfam0561095 DUF779 Protein of unknown function (DUF779). This famil 93.86
COG4918114 Uncharacterized protein conserved in bacteria [Function 97.24
>TIGR00049 TIGR00049 iron-sulfur cluster assembly accessory protein; InterPro: IPR016092 This family includes HesB which may be involved in nitrogen fixation; the hesB gene is expressed only under nitrogen fixation conditions Back     alignment and domain information
>PRK13623 iron-sulfur cluster insertion protein ErpA; Provisional Back     alignment and domain information
>PRK09502 iscA iron-sulfur cluster assembly protein; Provisional Back     alignment and domain information
>COG0316 sufA Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09504 sufA iron-sulfur cluster assembly scaffold protein; Provisional Back     alignment and domain information
>TIGR01997 sufA_proteo FeS assembly scaffold SufA; InterPro: IPR011298 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>KOG1120 consensus Back     alignment and domain information
>PRK11190 putative DNA uptake protein; Provisional Back     alignment and domain information
>TIGR03341 YhgI_GntY IscR-regulated protein YhgI Back     alignment and domain information
>TIGR02011 IscA iron-sulfur cluster assembly protein IscA; InterPro: IPR011302 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>KOG1119 consensus Back     alignment and domain information
>pfam01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis Back     alignment and domain information
>TIGR01911 HesB_rel_seleno HesB-related (seleno)protein; InterPro: IPR010965 This entry represents a family of small proteins related to HesB and its close homologs, which are likely to be involved in iron-sulphur cluster assembly Back     alignment and domain information
>COG4841 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3564 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam05610 DUF779 Protein of unknown function (DUF779) Back     alignment and domain information
>COG4918 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
2apn_A114 Hi1723 Solution Structure Length = 114 5e-30
1nwb_A124 Solution Nmr Structure Of Protein Aq_1857 From Aqui 3e-27
1r94_A118 Crystal Structure Of Isca (Mercury Derivative) Leng 2e-25
1s98_A107 E.Coli Isca Crystal Structure To 2.3 A Length = 107 2e-25
2d2a_A145 Crystal Structure Of Escherichia Coli Sufa Involved 1e-23
1x0g_A112 Crystal Structure Of Isca With The [2fe-2s] Cluster 4e-16
2k4z_A125 Solution Nmr Structure Of Allochromatium Vinosum Ds 2e-04
gi|116666731|pdb|2APN|A Chain A, Hi1723 Solution Structure Length = 114 Back     alignment and structure
 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           M+  +T T+AA  ++K ++   +     +R+ +  GGC+G +Y      +   DGD  IE
Sbjct: 5   MAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDLTIE 63

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEI 111
           K GV++ ID  SL Y++G  +D+      S F  +NPN  S CGCG S  I
Sbjct: 64  KSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI 114


>gi|31615730|pdb|1NWB|A Chain A, Solution Nmr Structure Of Protein Aq_1857 From Aquifex Aeolicus: Northeast Structural Genomics Consortium Target Qr6 Length = 124 Back     alignment and structure
>gi|40889628|pdb|1R94|A Chain A, Crystal Structure Of Isca (Mercury Derivative) Length = 118 Back     alignment and structure
>gi|49258913|pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To 2.3 A Length = 107 Back     alignment and structure
>gi|85544500|pdb|2D2A|A Chain A, Crystal Structure Of Escherichia Coli Sufa Involved In Biosynthesis Of Iron-Sulfur Clusters Length = 145 Back     alignment and structure
gi|109156916|pdb|1X0G|A Chain A, Crystal Structure Of Isca With The [2fe-2s] Cluster Length = 112 Back     alignment and structure
>gi|194368480|pdb|2K4Z|A Chain A, Solution Nmr Structure Of Allochromatium Vinosum Dsrr: Northeast Structural Genomics Consortium Target Op5 Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur clus 1e-28
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural genomics, 3e-26
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, me 2e-25
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swa 1e-24
2apn_A114 Protein HI1723; HI1723 solution structure, structural g 8e-23
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomics, PS 2e-18
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Length = 118 Back     alignment and structure
 Score =  119 bits (300), Expect = 1e-28
 Identities = 42/114 (36%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIE 60
           MS  +T++++A  R+   +  ++GK  G+R+ ++  GC+G+ Y+++ V + P   D + E
Sbjct: 1   MS--ITLSDSAAARVNTFL-ANRGKGFGLRLGVRTSGCSGMAYVLEFVDE-PTPEDIVFE 56

Query: 61  KDGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
             GVKV +D  SL ++ GT++DF  E L  GF F NPN    CGCG+S ++  A
Sbjct: 57  DKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFKLAAA 110


>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Length = 124 Back     alignment and structure
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Length = 145 Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Length = 112 Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Length = 114 Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Length = 125 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
2d2a_A145 SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, me 100.0
1nwb_A124 Hypothetical protein AQ_1857; QR6, structural genomics, 100.0
1r94_A118 Protein YFHF; tetrameric, beta barrel, iron-sulfur clus 100.0
1x0g_A112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swa 100.0
2apn_A114 Protein HI1723; HI1723 solution structure, structural g 100.0
2k4z_A125 DSRR; ISCA/SUFA/HESB like fold, structural genomics, PS 99.96
2qgo_A141 Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 103 98.2
2p2e_A128 Putative Fe-S biosynthesis protein; hypothetical protei 97.79
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=2.1e-39  Score=240.87  Aligned_cols=107  Identities=38%  Similarity=0.720  Sum_probs=99.1

Q ss_pred             CCEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHCCCCCCCCEECCCCEEEEECHHHHHHHCCCEEE
Q ss_conf             61652689999999999717998618999984798787113200110021012220124683999978773200698997
Q gi|254781064|r    3 DIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEID   82 (116)
Q Consensus         3 ~mi~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~g~~ID   82 (116)
                      +.|+||++|+++|++++++++ +..+|||+|++|||+||+|.|+++ +.+.++|.+++.+|++|+||+.|++||.|++||
T Consensus        39 q~ItITd~A~~~ik~ll~~~~-~~~~LRi~Vk~GGCsGf~Y~l~~~-~~~~~dD~v~~~~g~~v~Vd~~S~~~L~Gs~ID  116 (145)
T 2d2a_A           39 QGLTLTPAAAIHIRELVAKQP-GMVGVRLGVKQTGCAGFGYVLDSV-SEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVD  116 (145)
T ss_dssp             CCCEECHHHHHHHHHHHHHST-TCCEEEEEEEEETTTEEEEEEEEE-SSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEE
T ss_pred             CEEEECHHHHHHHHHHHHHCC-CCEEEEEEEECCCCCCEEEECCCC-CCCCCCCEEEECCCCEEEEEHHHHHHCCCCEEE
T ss_conf             608999999999999997399-961799999378648858573536-235678558973898999986886445897998


Q ss_pred             EECCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             63177445128988887876788521121
Q gi|254781064|r   83 FKTEKLYSGFVFHNPNQVSACGCGQSVEI  111 (116)
Q Consensus        83 y~~~~~~~~F~~~NPna~~~CgCG~SF~~  111 (116)
                      |++++++++|+|+||||+++||||+||+|
T Consensus       117 y~~~~~gsgF~f~NPNa~~~CGCG~SFsV  145 (145)
T 2d2a_A          117 FVREGLNQIFKFHNPKAQNECGCGESFGV  145 (145)
T ss_dssp             EEEETTEEEEEEECTTTCSCCCCBCEEEC
T ss_pred             EEECCCCCEEEEECCCCCCCCCCCCCCCC
T ss_conf             85668867079989998952389877569



>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1 Back     alignment and structure
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A Back     alignment and structure
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2apn_A Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Back     alignment and structure
>2k4z_A DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure
>2qgo_A Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2p2e_A Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118} SCOP: b.124.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
d1s98a_97 b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Esche 1e-18
d1nwba_101 b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex ae 4e-17
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: HesB-like domain
superfamily: HesB-like domain
family: HesB-like domain
domain: Fe-S scaffold protein IscA (YfhF)
species: Escherichia coli [TaxId: 562]
 Score = 85.0 bits (210), Expect = 1e-18
 Identities = 33/97 (34%), Positives = 58/97 (59%), Gaps = 2/97 (2%)

Query: 5   VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGV 64
           +T++++A  R+   +  ++GK  G+R+ ++  GC+G+ Y+++   D P   D + E  GV
Sbjct: 2   ITLSDSAAARVNTFL-ANRGKGFGLRLGVRTSGCSGMAYVLEF-VDEPTPEDIVFEDKGV 59

Query: 65  KVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVS 101
           KV +D  S+ ++ GT++DF  E L  GF F NPN   
Sbjct: 60  KVVVDGKSMQFLDGTQLDFVKEGLNEGFKFTNPNVKD 96


>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
d1s98a_97 Fe-S scaffold protein IscA (YfhF) {Escherichia coli [Ta 99.96
d1nwba_101 Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 99.96
d2p2ea1118 Putative Fe-S biosynthesis protein LSL1730 {Lactobacill 98.02
>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: HesB-like domain
superfamily: HesB-like domain
family: HesB-like domain
domain: Fe-S scaffold protein IscA (YfhF)
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=2.8e-30  Score=188.37  Aligned_cols=96  Identities=35%  Similarity=0.716  Sum_probs=89.0

Q ss_pred             EEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHCCCCCCCCEECCCCEEEEECHHHHHHHCCCEEEEE
Q ss_conf             65268999999999971799861899998479878711320011002101222012468399997877320069899763
Q gi|254781064|r    5 VTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTEIDFK   84 (116)
Q Consensus         5 i~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~g~~IDy~   84 (116)
                      |+||++|+++|++++++++ ++++|||+|++|||+||+|.|.|. +.+.++|.+++.+|++|+||+.|++||.|++|||+
T Consensus         2 I~iT~~A~~~i~~ll~~~~-~~~~lRi~v~~gGCsG~~Y~l~~~-~~~~~~D~~~~~~g~~i~id~~s~~~L~G~~IDy~   79 (97)
T d1s98a_           2 ITLSDSAAARVNTFLANRG-KGFGLRLGVRTSGCSGMAYVLEFV-DEPTPEDIVFEDKGVKVVVDGKSMQFLDGTQLDFV   79 (97)
T ss_dssp             CEECHHHHHHHHHHHHTTC-CCCEEEEEEEEETTTEEEEEEEEE-SSCCTTEEEEEETTEEEEEEGGGHHHHTTCEEEEE
T ss_pred             EEECHHHHHHHHHHHHHCC-CCCEEEEEEECCCCCCCEEEEEEC-CCCCCCCEEEECCCCEEEEEHHHHHHHCCCEEEEE
T ss_conf             8989999999999997389-981799999718977636776005-45899969987289999982799987389999885


Q ss_pred             CCCCCCEEEEECCCCCCC
Q ss_conf             177445128988887876
Q gi|254781064|r   85 TEKLYSGFVFHNPNQVSA  102 (116)
Q Consensus        85 ~~~~~~~F~~~NPna~~~  102 (116)
                      +++++++|+|+||||++.
T Consensus        80 ~~~~~~gF~f~NPNak~e   97 (97)
T d1s98a_          80 KEGLNEGFKFTNPNVKDE   97 (97)
T ss_dssp             CSSTTCEEEEECTTSCCC
T ss_pred             ECCCCCCEEEECCCCCCC
T ss_conf             668868469989888898



>d1nwba_ b.124.1.1 (A:) Hypothetical protein Aq_1857 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p2ea1 b.124.1.1 (A:3-120) Putative Fe-S biosynthesis protein LSL1730 {Lactobacillus salivarius [TaxId: 1624]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 116 FeS assembly scaffold SufA [Candidatus Liberibacte
1x0g_A_112 (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, 1e-27
2apn_A_114 (A:) Protein HI1723; HI1723 solution structure, st 3e-27
2d2a_A_145 (A:) SUFA protein; iron-sulfur cluster, iron, ISCA 5e-27
2qgo_A_141 (A:) Putative Fe-S biosynthesis protein; PSI-2, NY 2e-20
2p2e_A_128 (A:) Putative Fe-S biosynthesis protein; hypotheti 3e-11
1r94_A_1-22_70-11871 (A:1-22,A:70-118) Protein YFHF; tetrameric, beta b 6e-13
1nwb_A_1-29_82-12472 (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR 6e-12
1nwb_A_30-8152 (A:30-81) Hypothetical protein AQ_1857; QR6, struc 5e-11
1r94_A_23-6947 (A:23-69) Protein YFHF; tetrameric, beta barrel, i 1e-10
>1x0g_A (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus}Length = 112 Back     alignment and structure
 Score =  116 bits (291), Expect = 1e-27
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 4   IVTMTEAAVYRIKEIV--FNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEK 61
           +V +T AA+  ++ +      +G+A  +RI ++   C    Y + LV   P   D L + 
Sbjct: 1   MVELTPAAIQELERLQTHGVRRGQAAILRIQVQPSECGDWRYDLALV-AEPKPTDLLTQS 59

Query: 62  DGVKVWIDSASLLYMLGTEIDFKTEKLYSGFVFHNPNQVSACGCGQSVEIKRA 114
            G  + I + +   + G  +D+  + +   F FHNPN    CGCG +  + R+
Sbjct: 60  QGWTIAIAAEAAELLRGLRVDYIEDLMGGAFRFHNPNASQTCGCGMAFRVSRS 112


>2apn_A (A:) Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae}Length = 114 Back     alignment and structure
>2d2a_A (A:) SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli}Length = 145 Back     alignment and structure
>2qgo_A (A:) Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm}Length = 141 Back     alignment and structure
>2p2e_A (A:) Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118}Length = 128 Back     alignment and structure
>1r94_A (A:1-22,A:70-118) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli}Length = 71 Back     alignment and structure
>1nwb_A (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus}Length = 72 Back     alignment and structure
>1nwb_A (A:30-81) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus}Length = 52 Back     alignment and structure
>1r94_A (A:23-69) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli}Length = 47 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target116 FeS assembly scaffold SufA [Candidatus Liberibacter asi
2apn_A_114 Protein HI1723; HI1723 solution structure, structu 100.0
2d2a_A_145 SUFA protein; iron-sulfur cluster, iron, ISCA, YAD 100.0
1x0g_A_112 ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domai 100.0
2qgo_A_141 Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC 99.83
2p2e_A_128 Putative Fe-S biosynthesis protein; hypothetical p 99.45
1r94_A_1-22_70-11871 Protein YFHF; tetrameric, beta barrel, iron-sulfur 99.61
1nwb_A_1-29_82-12472 Hypothetical protein AQ_1857; QR6, structural geno 99.52
2k4z_A_1-41_90-12577 DSRR; ISCA/SUFA/HESB like fold, structural genomic 94.76
1nwb_A_30-8152 Hypothetical protein AQ_1857; QR6, structural geno 99.38
1r94_A_23-6947 Protein YFHF; tetrameric, beta barrel, iron-sulfur 99.22
2k4z_A_42-8948 DSRR; ISCA/SUFA/HESB like fold, structural genomic 92.42
>2apn_A (A:) Protein HI1723; HI1723 solution structure, structural genomics, structure 2 function project, S2F, unknown function; NMR {Haemophilus influenzae} Back     alignment and structure
Probab=100.00  E-value=1.2e-36  Score=226.27  Aligned_cols=110  Identities=35%  Similarity=0.651  Sum_probs=104.9

Q ss_pred             CCCCEEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEHHHHCCCCCCCCEECCCCEEEEECHHHHHHHCCCE
Q ss_conf             98616526899999999997179986189999847987871132001100210122201246839999787732006989
Q gi|254781064|r    1 MSDIVTMTEAAVYRIKEIVFNSQGKAQGIRISLKKGGCAGLEYMVDLVTDNPVDGDDLIEKDGVKVWIDSASLLYMLGTE   80 (116)
Q Consensus         1 M~~mi~IT~~A~~~i~~l~~~~~~~~~~lRi~v~~gGC~G~~Y~l~~~~~~~~~~D~~~~~~g~~i~id~~s~~~L~g~~   80 (116)
                      |+.||+||++|+++|++++++++.++++|||.|+++||+|++|.|.+. +++.++|.+++.+|++|+||+.+++||+|++
T Consensus         5 ~~~~i~IT~~A~~~i~~ll~~~~~~~~~lRi~v~~~GC~G~~y~l~~~-~~~~~~D~v~~~~g~~v~id~~~~~~l~g~~   83 (114)
T 2apn_A            5 MAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFD-EKVNDGDLTIEKSGVQLVIDPMSLQYLIGGT   83 (114)
T ss_dssp             SCCSCEECSHHHHHHHHHHHHHTCSSCEEEECCCCSSSSCSCCCEEEC-CSCCSSCEEEECSSSEEEECHHHHHHHTTCE
T ss_pred             CCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCEEEEECC-CCCCCCCEEEEECCEEEEECCHHHHCCCCCE
T ss_conf             668828899999999999985799972699998458889815653014-6679997899949959999852641018989


Q ss_pred             EEEECCCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             9763177445128988887876788521121
Q gi|254781064|r   81 IDFKTEKLYSGFVFHNPNQVSACGCGQSVEI  111 (116)
Q Consensus        81 IDy~~~~~~~~F~~~NPna~~~CgCG~SF~~  111 (116)
                      |||+++..+++|+|+|||++++||||+||++
T Consensus        84 iDy~~~~~~~gF~i~nPn~~~~C~CG~sf~~  114 (114)
T 2apn_A           84 VDYTEGLEGSRFTVNNPNATSTCGCGSSFSI  114 (114)
T ss_dssp             EEEECSSSCCEEEEECHHHHCCCCCCCCSCC
T ss_pred             EEEEECCCCCCEEEECCCCCCCCCCCCCCCC
T ss_conf             9986568866279979997966389754409



>2d2a_A (A:) SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli} Back     alignment and structure
>1x0g_A (A:) ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2qgo_A (A:) Putative Fe-S biosynthesis protein; PSI-2, NYSGXRC, 10399G, Fe-S cluster protein, structural genomics; 2.04A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2p2e_A (A:) Putative Fe-S biosynthesis protein; hypothetical protein, beta-barrel, structural genomics, protein structure initiative, PSI-2; 2.48A {Lactobacillus salivarius UCC118} Back     alignment and structure
>1r94_A (A:1-22,A:70-118) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} Back     alignment and structure
>1nwb_A (A:1-29,A:82-124) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} Back     alignment and structure
>2k4z_A (A:1-41,A:90-125) DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure
>1nwb_A (A:30-81) Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} Back     alignment and structure
>1r94_A (A:23-69) Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} Back     alignment and structure
>2k4z_A (A:42-89) DSRR; ISCA/SUFA/HESB like fold, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Allochromatium vinosum} Back     alignment and structure