254781065

254781065

L-lysine 2,3-aminomutase protein

GeneID in NCBI database:8210088Locus tag:CLIBASIA_04835
Protein GI in NCBI database:254781065Protein Accession:YP_003065478.1
Gene range:-(1068638, 1069696)Protein Length:352aa
Gene description:L-lysine 2,3-aminomutase protein
COG prediction:[E] Lysine 2,3-aminomutase
KEGG prediction:kamA; L-lysine 2,3-aminomutase protein; K01843 lysine 2,3-aminomutase [EC:5.4.3.2]
SEED prediction:Lysine 2,3-aminomutase (EC 5.4.3.2)
Pathway involved in KEGG:Lysine degradation [PATH:las00310]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
cccccHHHccHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHccccccccHHHHHccccHHHcccccccccccccHHHHcccccEEEEEccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEcccHHHcHHHccHHHHHHHHHccccEEEEEEccccHHccHHHHHHHHHHHHcccEEEEcEEEcccccccHHHHHHHHHHHHHcccccEEEEEEcccccccEEEccHHHHHHHHHHHHHHccccEEEEEEEccccccccEEEcHHHHccccccEEEEEcccccEEEcccccc
ccccccccccHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHcccccccccHHEEEcccHHHHHcccccccccccccccccccccEEcccccEEEEEcccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccHHEEEEcccccccccHHHHHHHHHHHHccccEEEEEEcccccEEccccccHHHHHHHHHccccEEEEEccccHHHccHHHHHHHHHHHHcccccccHHHHHccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHHHHccccccccEEEEEcccccccccccccEEEEccccEEEEEccccEEEEcccccc
mqlrhktlTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIAnlinphnpndpiarqfipqkeelnilpeeredpigdnnhsplkgivhrypDRILLKLLhvcpvycrfcfrremvgsqkgtvlssKDTEAALAYIQEKSQIWEVIftggdpliLSHKRLQKVLKTLRYIKHVQILRfhsrvpivdpqrinPELIQCLKEAGKPVYIAIHanhpyefsEEAIAAISRLANAGIILLSQSVLlkginddpEILANLMRTFVELRikpyylhhpdlaagtshfRLTIEEGQKIVASLKEKIsglcqpfyildlpggygkvkidthnikkvgngsycitdhhnivhdyppkss
mqlrhktltsaqdlyNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRremvgsqkgtvlssKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVqilrfhsrvpivdpqrINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCitdhhnivhdyppkss
MQLRHKTLTSAQDLYNANLikkeqideikeiSNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVG*********KDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYP****
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
***RHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS
MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
254781120384 radical SAM protein [Candidatus Liberibacter asiat 0.040
>gi|254781120|ref|YP_003065533.1| radical SAM protein [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 30.8 bits (68), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 68/193 (35%), Gaps = 46/193 (23%)

Query: 105 CPVYCRFCFRREMVGSQK---------------------GTVLSSKDTEAALAYIQEKSQ 143
           C + C FC+     G+QK                     G     +D E  +       +
Sbjct: 124 CSLTCSFCY----TGTQKLVRNLTAEEILLQVLLARSLLGDFPGCEDIEG-MVIPSVGRK 178

Query: 144 IWEVIFTG-GDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKE 202
           I  ++  G G+PL         V K+L        L F  R   +      P + +  +E
Sbjct: 179 ISNIVMMGMGEPLC----NFDNVKKSLSIASDSMGLSFSKRRITLSTSGFVPNIARVGEE 234

Query: 203 AGKPVYIAIHA--------------NHPYEFSEEAIAAISRLANAGIILLSQSVLLKGIN 248
            G  + I++HA               +P E   +A      L+NA  I   + V+LKGIN
Sbjct: 235 IGVMLAISLHAVSNDLRNILVPINRKYPLEMLIDACRHYPGLSNARRITF-EYVMLKGIN 293

Query: 249 DDPEILANLMRTF 261
           D P    NL++  
Sbjct: 294 DSPRDALNLIKIL 306

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
315122590351 L-lysine 2,3-aminomutase protein [Candidatus Liberibact 1 1e-169
227824114350 lysine 2,3-aminomutase YodO family protein [Sinorhizobi 1 1e-125
116254324350 L-lysine 2,3-aminomutase [Rhizobium leguminosarum bv. v 1 1e-123
86359621349 L-lysine 2,3-aminomutase protein [Rhizobium etli CFN 42 1 1e-122
15964028350 hypothetical protein SMc00355 [Sinorhizobium meliloti 1 1 1e-122
209551368350 lysine 2,3-aminomutase YodO family protein [Rhizobium l 1 1e-122
15889814363 L-lysine 2,3-aminomutase [Agrobacterium tumefaciens str 1 1e-122
241206810350 lysine 2,3-aminomutase YodO family protein [Rhizobium l 1 1e-121
190893895350 L-lysine 2,3-aminomutase [Rhizobium etli CIAT 652] Leng 1 1e-121
218674354350 L-lysine 2,3-aminomutase protein [Rhizobium etli GR56] 1 1e-121
>gi|315122590|ref|YP_004063079.1| L-lysine 2,3-aminomutase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 351 Back     alignment and organism information
 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 285/351 (81%), Positives = 320/351 (91%)

Query: 1   MQLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQF 60
           M    + LTSAQ LY A LI++EQI+ IKEISNHYSIALTP +ANLI+PHNPNDPIARQF
Sbjct: 1   MNSHDQKLTSAQQLYKAKLIEQEQINTIKEISNHYSIALTPFMANLIDPHNPNDPIARQF 60

Query: 61  IPQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGS 120
           IPQKEE+NILPEEREDPIGD+NHSPLKGIVHRYPDR+LLKLLH+CPVYCRFCFRREMVGS
Sbjct: 61  IPQKEEMNILPEEREDPIGDSNHSPLKGIVHRYPDRVLLKLLHICPVYCRFCFRREMVGS 120

Query: 121 QKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRF 180
           QKGT+LS +D +AAL+YIQ   +IWEVIFTGGDPLILS  RL+ VLK L  IKHV+ILRF
Sbjct: 121 QKGTILSPQDIDAALSYIQNHPKIWEVIFTGGDPLILSLNRLKTVLKMLMEIKHVKILRF 180

Query: 181 HSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQ 240
           HSRVPIVDPQRI+PE IQCLKE+GKP+YIAIHANHP EFS+E+++AIS+LA+AGIILLSQ
Sbjct: 181 HSRVPIVDPQRISPEFIQCLKESGKPIYIAIHANHPREFSQESLSAISKLADAGIILLSQ 240

Query: 241 SVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEK 300
           SVLLKGINDDP+ILA+LMR FVE RIKPYYLHHPDLA GTSHFRLTIEEGQKIVASLKE 
Sbjct: 241 SVLLKGINDDPKILADLMRIFVESRIKPYYLHHPDLAPGTSHFRLTIEEGQKIVASLKEN 300

Query: 301 ISGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPKS 351
           ISG+CQPFYILD+PGGYGKVKID+HNIKK+ + SY ITDH+NIVH YPP+S
Sbjct: 301 ISGICQPFYILDIPGGYGKVKIDSHNIKKIDDESYLITDHNNIVHHYPPRS 351


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227824114|ref|YP_002828087.1| lysine 2,3-aminomutase YodO family protein [Sinorhizobium fredii NGR234] Length = 350 Back     alignment and organism information
>gi|116254324|ref|YP_770162.1| L-lysine 2,3-aminomutase [Rhizobium leguminosarum bv. viciae 3841] Length = 350 Back     alignment and organism information
>gi|86359621|ref|YP_471513.1| L-lysine 2,3-aminomutase protein [Rhizobium etli CFN 42] Length = 349 Back     alignment and organism information
>gi|15964028|ref|NP_384381.1| hypothetical protein SMc00355 [Sinorhizobium meliloti 1021] Length = 350 Back     alignment and organism information
>gi|209551368|ref|YP_002283285.1| lysine 2,3-aminomutase YodO family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 350 Back     alignment and organism information
>gi|15889814|ref|NP_355495.1| L-lysine 2,3-aminomutase [Agrobacterium tumefaciens str. C58] Length = 363 Back     alignment and organism information
>gi|241206810|ref|YP_002977906.1| lysine 2,3-aminomutase YodO family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 350 Back     alignment and organism information
>gi|190893895|ref|YP_001980437.1| L-lysine 2,3-aminomutase [Rhizobium etli CIAT 652] Length = 350 Back     alignment and organism information
>gi|218674354|ref|ZP_03524023.1| L-lysine 2,3-aminomutase protein [Rhizobium etli GR56] Length = 350 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
TIGR03822321 TIGR03822, AblA_like_2, lysine-2,3-aminomutase-related 1e-136
TIGR03820417 TIGR03820, lys_2_3_AblA, lysine-2,3-aminomutase 1e-79
TIGR00238331 TIGR00238, TIGR00238, KamA family protein 3e-70
COG1509369 COG1509, KamA, Lysine 2,3-aminomutase [Amino acid trans 1e-113
TIGR03821321 TIGR03821, AblA_like_1, lysine-2,3-aminomutase-related 1e-60
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 2e-10
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family, Rad 3e-06
COG0535347 COG0535, COG0535, Predicted Fe-S oxidoreductases [Gener 1e-04
cd01335204 cd01335, Radical_SAM, Radical SAM superfamily 2e-06
>gnl|CDD|163534 TIGR03822, AblA_like_2, lysine-2,3-aminomutase-related protein Back     alignment and domain information
>gnl|CDD|163532 TIGR03820, lys_2_3_AblA, lysine-2,3-aminomutase Back     alignment and domain information
>gnl|CDD|161784 TIGR00238, TIGR00238, KamA family protein Back     alignment and domain information
>gnl|CDD|31698 COG1509, KamA, Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163533 TIGR03821, AblA_like_1, lysine-2,3-aminomutase-related protein Back     alignment and domain information
>gnl|CDD|146602 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|128968 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|30881 COG0535, COG0535, Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|100105 cd01335, Radical_SAM, Radical SAM superfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport and m 100.0
TIGR02351378 thiH thiazole biosynthesis protein ThiH; InterPro: IPR0 91.47
TIGR00238357 TIGR00238 lysine 2,3-aminomutase YodO family protein; I 100.0
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . This entry represents the bacterial form of MoaA (molybdenum cofactor biosynthesis protein A). The MoaA protein is a member of the wider S-adenosylmethionine(SAM)-dependent enzyme family which catalyze the formation of protein and/or substrate radicals by reductive cleavage of SAM via a [4Fe-4S] cluster. Monomeric and homodimeric forms of MoaA have been observed in vivo, and it is not clear what the physiologically relevant form of the enzyme is . The core of each monomer consists of an incomplete TIM barrel, formed by the N-terminal region of the protein, containing a [4Fe-4S] cluster. The C-terminal region of the protein, which also contains a [4Fe-4S] cluster consists of a beta-sheet covering the lateral opening of the barrel, an extended loop and three alpha helices. The N-terminal [4Fe-4S] cluster is coordinated with 3 cysteines and an exchangeable SAM molecule, while the C-terminal [4Fe-4S], also coordinated with 3 cysteines, is the binding and activation site for GTP .; GO: 0046872 metal ion binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02666">TIGR02666346 moaA molybdenum cofactor biosynthesis protein A; InterP 99.71
PRK13361329 molybdenum cofactor biosynthesis protein A; Provisional 99.64
PRK00164334 moaA molybdenum cofactor biosynthesis protein A; Review 99.61
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 99.28
TIGR02668324 moaA_archaeal probable molybdenum cofactor biosynthesis 99.18
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM prote 99.17
PRK11194372 hypothetical protein; Provisional 98.96
TIGR00089455 TIGR00089 RNA modification enzyme, MiaB family; InterPr 98.75
PRK06256325 biotin synthase; Validated 98.67
PRK07094323 biotin synthase; Provisional 98.62
COG2100414 Predicted Fe-S oxidoreductase [General function predict 98.55
COG0820349 Predicted Fe-S-cluster redox enzyme [General function p 98.52
PRK06294374 coproporphyrinogen III oxidase; Provisional 98.34
COG0731296 Fe-S oxidoreductases [Energy production and conversion] 98.33
PRK05660378 coproporphyrinogen III oxidase; Provisional 98.25
PRK05628376 coproporphyrinogen III oxidase; Validated 98.24
PRK05904353 coproporphyrinogen III oxidase; Provisional 98.21
PRK08807 385 consensus 98.14
PRK05799374 coproporphyrinogen III oxidase; Provisional 98.13
PRK07379 399 coproporphyrinogen III oxidase; Provisional 98.11
PRK06267324 hypothetical protein; Provisional 97.97
PRK09057 381 coproporphyrinogen III oxidase; Provisional 97.94
PRK08949378 consensus 97.93
TIGR01574456 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme Mia 97.93
PRK09058 447 coproporphyrinogen III oxidase; Provisional 97.91
COG0635 416 HemN Coproporphyrinogen III oxidase and related Fe-S ox 97.88
PRK13347 453 coproporphyrinogen III oxidase; Provisional 97.87
PRK08599 377 coproporphyrinogen III oxidase; Provisional 97.78
TIGR02109363 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; Inter 97.73
COG1032490 Fe-S oxidoreductase [Energy production and conversion] 97.69
PRK06582 390 coproporphyrinogen III oxidase; Provisional 97.63
TIGR00048378 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR 97.61
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 97.58
PRK08444353 hypothetical protein; Provisional 97.45
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin sy 97.44
PRK05927350 hypothetical protein; Provisional 97.41
PRK08508279 biotin synthase; Provisional 97.32
PRK07360375 FO synthase subunit 2; Reviewed 97.27
COG1625 414 Fe-S oxidoreductase, related to NifB/MoaA family [Energ 97.25
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related unch 97.08
PRK05926371 hypothetical protein; Provisional 97.0
PRK08898 393 coproporphyrinogen III oxidase; Provisional 96.94
TIGR00423331 TIGR00423 conserved hypothetical protein TIGR00423; Int 96.77
COG1243 515 ELP3 Histone acetyltransferase [Transcription / Chromat 96.45
PRK09234846 fbiC FO synthase; Reviewed 96.35
TIGR00539371 hemN_rel putative oxygen-independent coproporphyrinogen 95.79
PRK06245336 cofG FO synthase subunit 1; Reviewed 95.79
PRK09613 471 thiH thiamine biosynthesis protein ThiH; Reviewed 95.58
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 94.88
COG1244358 Predicted Fe-S oxidoreductase [General function predict 93.06
PRK08207497 coproporphyrinogen III oxidase; Provisional 92.09
PRK09234 846 fbiC FO synthase; Reviewed 91.98
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme 99.55
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of this fa 99.09
TIGR01579492 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: 98.97
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, ribos 98.95
COG0641 378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [Gen 98.9
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM. Thi 98.87
COG0535347 Predicted Fe-S oxidoreductases [General function predic 98.85
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 98.55
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; Provis 98.46
TIGR02495220 NrdG2 anaerobic ribonucleoside-triphosphate reductase a 98.46
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Posttran 98.38
PRK08446351 coproporphyrinogen III oxidase; Provisional 97.95
COG1533297 SplB DNA repair photolyase [DNA replication, recombinat 97.87
PRK09249 456 coproporphyrinogen III oxidase; Provisional 97.81
TIGR01290 461 nifB nitrogenase cofactor biosynthesis protein NifB; In 97.73
PRK08629 424 coproporphyrinogen III oxidase; Provisional 97.07
KOG2876323 consensus 96.99
TIGR01125475 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR011 96.82
COG1313335 PflX Uncharacterized Fe-S protein PflX, homolog of pyru 95.25
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 92.33
pfam12544127 LAM_C Lysine-2,3-aminomutase. This domain family is fou 99.51
PRK13758370 anaerobic sulfatase-maturase; Provisional 99.12
PRK13745 412 anaerobic sulfatase-maturase; Provisional 98.97
pfam04055165 Radical_SAM Radical SAM superfamily. Radical SAM protei 98.75
TIGR02493243 PFLA pyruvate formate-lyase 1-activating enzyme; InterP 97.21
TIGR02494305 PFLE_PFLC glycyl-radical enzyme activating protein fami 97.09
COG5014228 Predicted Fe-S oxidoreductase [General function predict 97.07
TIGR02026506 BchE magnesium-protoporphyrin IX monomethyl ester anaer 93.37
PRK08208 436 coproporphyrinogen III oxidase; Validated 98.36
PRK08207497 coproporphyrinogen III oxidase; Provisional 98.06
COG0602212 NrdG Organic radical activating enzymes [Posttranslatio 97.92
TIGR02491158 NrdG anaerobic ribonucleoside-triphosphate reductase ac 97.57
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesi 97.31
PRK11121154 nrdG anaerobic ribonucleotide reductase-activating prot 97.24
PRK08445348 hypothetical protein; Provisional 97.18
COG2108353 Uncharacterized conserved protein related to pyruvate f 96.97
TIGR01578487 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-t 96.05
PRK10076213 pyruvate formate lyase II activase; Provisional 97.37
TIGR03278 404 methan_mark_10 putative methanogenesis marker protein 1 97.22
COG1964 475 Predicted Fe-S oxidoreductases [General function predic 96.61
COG1856275 Uncharacterized homolog of biotin synthetase [Function 96.4
PRK13762321 tRNA-modifying enzyme; Provisional 95.93
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacterial-sp 94.44
TIGR02329 658 propionate_PrpR propionate catabolism operon regulatory 90.69
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH; InterPro: IPR012726 Members of this protein family are the ThiH proteins involved in thiamine biosynthesis Back     alignment and domain information
>TIGR00238 TIGR00238 lysine 2,3-aminomutase YodO family protein; InterPro: IPR003739 This family represents essentially the whole of the Escherichia coli YjeK family and of some of its apparent orthologs Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A; InterPro: IPR013483 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A; InterPro: IPR013485 This entry consists of archaeal proteins which are predicted to be functionally equivalent to MoaA (molybdenum cofactor biosynthesis protein A) from bacteria (see IPR013483 from INTERPRO) Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK11194 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00089 TIGR00089 RNA modification enzyme, MiaB family; InterPro: IPR005839 This entry represents a family defined on the basis of sequence similarity Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-i(6)A37 thiotransferase enzyme MiaB; InterPro: IPR006463 These sequences are homologs of the MiaB enzyme responsible for the modification of the isopentenylated adenine-37 base of most bacterial and eukaryotic tRNAs that read codons beginning with uracil (all except tRNA(I,V) Ser) Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00048 TIGR00048 radical SAM enzyme, Cfr family; InterPro: IPR004383 This family of conserved hypothetical proteins groups bacterial proteins of unknown function Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00423 TIGR00423 conserved hypothetical protein TIGR00423; InterPro: IPR005244 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase; InterPro: IPR004559 Experimentally determined examples of oxygen-independent coproporphyrinogen III oxidase, an enzyme that replaces HemF function under anaerobic conditions, belong to a family of proteins called HemN (IPR004558 from INTERPRO) Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme; InterPro: IPR006467 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012840 This enzyme is a member of the radical-SAM family Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB; InterPro: IPR005980 NifB is a protein required for the biosynthesis of the iron-molybdenum (or iron-vanadium) cofactor used by the nitrogen-fixing enzyme nitrogenase Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>KOG2876 consensus Back     alignment and domain information
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840 This is a family of mainly hypothetical proteins of unknown function Back     alignment and domain information
>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only] Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>pfam12544 LAM_C Lysine-2,3-aminomutase Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>pfam04055 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme; InterPro: IPR012838 Members of this family are iron-sulphur proteins with a radical-SAM domain Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>COG5014 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase; InterPro: IPR011772 This entry respresents the cobalamin-dependent oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under anaerobic conditions Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837 This enzyme is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO) Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type; InterPro: IPR006466 This clade of sequences is closely related to MiaB, a modifier of isopentenylated adenosine-37 of certain eukaryotic and bacterial tRNAs (see IPR006463 from INTERPRO) Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>COG1964 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR; InterPro: IPR012704 At least five distinct pathways exist for the catabolism of propionate by way of propionyl-CoA Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
2a5h_A416 2.1 Angstrom X-Ray Crystal Structure Of Lysine-2,3- 1e-124
2fb2_A340 Structure Of The Moaa Arg17266268ALA TRIPLE MUTANT 0.003
1tv7_A340 Structure Of The S-Adenosylmethionine Dependent Enz 0.003
>gi|225734347|pdb|2A5H|A Chain A, 2.1 Angstrom X-Ray Crystal Structure Of Lysine-2,3- Aminomutase From Clostridium Subterminale Sb4, With Michaelis Analog (L-Alpha-Lysine External Aldimine Form Of Pyridoxal-5'-Phosphate). Length = 416 Back     alignment and structure
 Score =  450 bits (1157), Expect = e-124,   Method: Composition-based stats.
 Identities = 123/349 (35%), Positives = 204/349 (58%), Gaps = 3/349 (0%)

Query: 2   QLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFI 61
           Q+R++ + + ++L     + KE+ + + +       A+TP   +LI+P++PNDP+ +Q I
Sbjct: 23  QVRNR-IETVEELKKYIPLTKEEEEGVAQCVKSLRXAITPYYLSLIDPNDPNDPVRKQAI 81

Query: 62  PQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQ 121
           P   ELN    + EDP+ ++  SP+ G+ HRYPDR+LL +   C  YCR C RR   G  
Sbjct: 82  PTALELNKAAADLEDPLHEDTDSPVPGLTHRYPDRVLLLITDXCSXYCRHCTRRRFAGQS 141

Query: 122 KGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFH 181
             +    +  + A+ YI+   Q+ +V+ +GGD L++S + L+ ++  LR I HV+I+R  
Sbjct: 142 DDSXP-XERIDKAIDYIRNTPQVRDVLLSGGDALLVSDETLEYIIAKLREIPHVEIVRIG 200

Query: 182 SRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQS 241
           SR P+V PQRI PEL+  LK+   PV++  H NHP E +EE+  A   LA+AG+ L +QS
Sbjct: 201 SRTPVVLPQRITPELVNXLKKY-HPVWLNTHFNHPNEITEESTRACQLLADAGVPLGNQS 259

Query: 242 VLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKI 301
           VLL+G+ND   +   L+   V++R++PYY++  DL+ G  HFR  + +G +I+  L+   
Sbjct: 260 VLLRGVNDCVHVXKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEGLRGHT 319

Query: 302 SGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYPPK 350
           SG C P +++D PGG GK  +  + +    +    + +   ++  Y   
Sbjct: 320 SGYCVPTFVVDAPGGGGKTPVXPNYVISQSHDKVILRNFEGVITTYSEP 368


>gi|109157586|pdb|2FB2|A Chain A, Structure Of The Moaa Arg17266268ALA TRIPLE MUTANT Length = 340 Back     alignment and structure
gi|52695872|pdb|1TV7|A Chain A, Structure Of The S-Adenosylmethionine Dependent Enzyme Moaa Length = 340 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 2e-78
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Length = 416 Back     alignment and structure
 Score =  288 bits (737), Expect = 2e-78
 Identities = 124/347 (35%), Positives = 207/347 (59%), Gaps = 3/347 (0%)

Query: 2   QLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFI 61
           Q+R+  + + ++L     + KE+ + + +      +A+TP   +LI+P++PNDP+ +Q I
Sbjct: 23  QVRN-RIETVEELKKYIPLTKEEEEGVAQCVKSLRMAITPYYLSLIDPNDPNDPVRKQAI 81

Query: 62  PQKEELNILPEEREDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQ 121
           P   ELN    + EDP+ ++  SP+ G+ HRYPDR+LL +  +C +YCR C RR   G Q
Sbjct: 82  PTALELNKAAADLEDPLHEDTDSPVPGLTHRYPDRVLLLITDMCSMYCRHCTRRRFAG-Q 140

Query: 122 KGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFH 181
               +  +  + A+ YI+   Q+ +V+ +GGD L++S + L+ ++  LR I HV+I+R  
Sbjct: 141 SDDSMPMERIDKAIDYIRNTPQVRDVLLSGGDALLVSDETLEYIIAKLREIPHVEIVRIG 200

Query: 182 SRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQS 241
           SR P+V PQRI PEL+  LK    PV++  H NHP E +EE+  A   LA+AG+ L +QS
Sbjct: 201 SRTPVVLPQRITPELVNMLK-KYHPVWLNTHFNHPNEITEESTRACQLLADAGVPLGNQS 259

Query: 242 VLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKI 301
           VLL+G+ND   ++  L+   V++R++PYY++  DL+ G  HFR  + +G +I+  L+   
Sbjct: 260 VLLRGVNDCVHVMKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEGLRGHT 319

Query: 302 SGLCQPFYILDLPGGYGKVKIDTHNIKKVGNGSYCITDHHNIVHDYP 348
           SG C P +++D PGG GK  +  + +    +    + +   ++  Y 
Sbjct: 320 SGYCVPTFVVDAPGGGGKTPVMPNYVISQSHDKVILRNFEGVITTYS 366


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-four-s 100.0
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; TIM b 99.45
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM radica 99.05
2qgq_A304 Protein TM_1862; alpha-beta protein, structural genomic 98.55
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, FES c 98.46
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.40A {M 98.37
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; heme 98.22
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet radi 99.09
2yx0_A342 Radical SAM enzyme; predicted tRNA modification enzyme, 98.73
3can_A182 Pyruvate-formate lyase-activating enzyme; structural ge 97.95
1vp8_A201 Hypothetical protein AF0103; NP_068944.1, structural ge 90.02
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
Probab=100.00  E-value=0  Score=721.63  Aligned_cols=346  Identities=36%  Similarity=0.703  Sum_probs=336.9

Q ss_pred             CCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCHHHCCCCHHHCCCCCCCCCCCCCCC
Q ss_conf             33552249988998641999899999999985348438988995358997445011232699778013813353731000
Q gi|254781065|r    2 QLRHKTLTSAQDLYNANLIKKEQIDEIKEISNHYSIALTPVIANLINPHNPNDPIARQFIPQKEELNILPEEREDPIGDN   81 (352)
Q Consensus         2 Qlr~~~i~s~~~L~~~l~Ls~e~~~~~~~~~~~fp~~vtpyyl~LId~~dp~DPi~rQvlP~~~El~~~~~~~~DPl~E~   81 (352)
                      |+++ +|+++++|.++++|++++.++++.+.+.|||+|||||++||||+||+|||+||++|+.+|+...+++..||++|.
T Consensus        23 ql~~-~i~~~~~L~~~l~l~~~~~~~~~~~~~~~p~~vt~yy~~li~~~~p~dPi~rq~~P~~~e~~~~~~~~~Dp~~e~  101 (416)
T 2a5h_A           23 QVRN-RIETVEELKKYIPLTKEEEEGVAQCVKSLRMAITPYYLSLIDPNDPNDPVRKQAIPTALELNKAAADLEDPLHED  101 (416)
T ss_dssp             HHHT-CBCSHHHHHTTSCCCHHHHHHHHTCTTSCCCCBCHHHHTTSCTTCTTCHHHHHHSCCGGGGCCCTTCBSSTTCTT
T ss_pred             HHHH-HCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHCCCCCCCCHHHHHCCCCHHHCCCCCCCCCCCCCCC
T ss_conf             9999-788999999882989999999999985588748999998638999998788662899899678844445873212


Q ss_pred             CCCCCCCCEEECCCEEEEEECCCCCCHHHCCCCCCEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHH
Q ss_conf             00768871452075379997274300000112233012555567898999999999972997479997269813249899
Q gi|254781065|r   82 NHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKR  161 (352)
Q Consensus        82 ~~~p~pgl~hkY~~rvLl~~t~~C~~~CryCfR~~~~~~~~~~~~~~~~~~~~~~Yi~~~~eI~eVilSGGDPl~l~~~~  161 (352)
                      .++|+|||+|||++||||.+|++|++|||||||+++++... ..++.++|+++++||++|++|+||+|||||||+++|++
T Consensus       102 ~~~~~~gl~hkY~~rvll~vT~~Cn~~CrYC~R~~~~~~~~-~~l~~~ei~~~i~yi~~~~~I~~V~lTGGePL~r~d~~  180 (416)
T 2a5h_A          102 TDSPVPGLTHRYPDRVLLLITDMCSMYCRHCTRRRFAGQSD-DSMPMERIDKAIDYIRNTPQVRDVLLSGGDALLVSDET  180 (416)
T ss_dssp             TSCSBTTEECCSSSEEEEEEESCCSSCCTTCTTTTTTTSSS-SBCCHHHHHHHHHHHHTCTTCCEEEEEESCTTSSCHHH
T ss_pred             CCCCCCCCEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCC-CCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHH
T ss_conf             24888884001587589984575477287989877568643-43468999999999984898269999789734378899


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCEEEEEHHHCCHHHHHHHHHCCCCEEEEECCCCHHHCCHHHHHHHHHHHHCCCEEEECH
Q ss_conf             99999998619981289874343563434339999999862599389993369958869999999999998798982327
Q gi|254781065|r  162 LQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQS  241 (352)
Q Consensus       162 L~~ll~~L~~i~hv~~IRi~TR~pv~~P~Rit~~L~~~l~~~~~~~~iv~H~NHp~Elt~~~~~A~~~L~~~Gv~v~nQs  241 (352)
                      |.++++.|++|+||++||||||.|+++|+|++++|.+++.++ +++++++|+|||+|+++++.+|+++++++|++|.||+
T Consensus       181 L~~li~~l~~i~~i~~iri~T~~~~~~p~r~~~~L~~~g~~~-~nisldth~~h~~el~~~v~~~i~~l~~~Gi~vk~n~  259 (416)
T 2a5h_A          181 LEYIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVNMLKKY-HPVWLNTHFNHPNEITEESTRACQLLADAGVPLGNQS  259 (416)
T ss_dssp             HHHHHHHHHTSTTCCEEEEECSHHHHCGGGCCHHHHHHHGGG-CSEEEEECCCSGGGCCHHHHHHHHHHHHTTCCEEEEE
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHCC-CEEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEC
T ss_conf             999999998479986478880675447277799999877427-6389997427710055999999999997699487304


Q ss_pred             HHHHCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCEE
Q ss_conf             98623457889999999999986982423011345765210118699999999999982888654106631788888235
Q gi|254781065|r  242 VLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLPGGYGKVK  321 (352)
Q Consensus       242 VLLkgVND~~~~l~~L~~~L~~~gV~PYYl~~~d~v~G~~hf~v~~~~~~~i~~~l~~~lsG~~~P~~v~d~p~~~GKv~  321 (352)
                      |||||||||+++|.+|+++|+++||.|||+|++|++.|++||+||+++|++|++++++++||+++|+||+|+|||+||+|
T Consensus       260 VllkGvNDd~~~l~~L~~~l~~~gv~pyyi~~~d~~~g~~~f~v~~~~~~eI~~~l~~~l~G~~~p~~v~d~p~g~gK~~  339 (416)
T 2a5h_A          260 VLLRGVNDCVHVMKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEGLRGHTSGYCVPTFVVDAPGGGGKTP  339 (416)
T ss_dssp             ECCTTTTCSHHHHHHHHHHHHHTTEEEEEEECCCCBTTCGGGCCCHHHHHHHHHTTBTTBCGGGCCEEEEEETTTTEEEE
T ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCC
T ss_conf             05677438889999999999867976999983478874321567799999999999864888664157763589987635


Q ss_pred             ECCHHHEEECCCEEEEECCCCCEEECCCC
Q ss_conf             55102123139879998169988718988
Q gi|254781065|r  322 IDTHNIKKVGNGSYCITDHHNIVHDYPPK  350 (352)
Q Consensus       322 i~~~~~~~~~~~~~~l~~~~g~~~~yp~~  350 (352)
                      +.|+|+...+.+.+.+++++|++..|++|
T Consensus       340 l~p~~~~~~~~~~~~~~~~~G~ig~y~~p  368 (416)
T 2a5h_A          340 VMPNYVISQSHDKVILRNFEGVITTYSEP  368 (416)
T ss_dssp             CCCCCEEEEETTEEEEECTTCCEEEEECC
T ss_pred             CCCCCCCCCCCCEEEEECCCCCEEEECCC
T ss_conf             77632015788679997799858985578



>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; NP_068944.1, structural genomics, JCSG, joint center for structural genomics, PSI; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus dsm 4304} SCOP: c.49.1.2 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {Staphy 99.18
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 98.54
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase HemN 98.39
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: MoCo biosynthesis proteins
domain: Molybdenum cofactor biosynthesis protein A MoaA
species: Staphylococcus aureus [TaxId: 1280]
Probab=99.18  E-value=9.2e-09  Score=79.76  Aligned_cols=189  Identities=19%  Similarity=0.314  Sum_probs=125.9

Q ss_pred             EEEEECCCCCCHHHCCCCCCEECC-----CCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHC
Q ss_conf             799972743000001122330125-----555678989999999999729974799972698132498999999999861
Q gi|254781065|r   97 ILLKLLHVCPVYCRFCFRREMVGS-----QKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRY  171 (352)
Q Consensus        97 vLl~~t~~C~~~CryCfR~~~~~~-----~~~~~~~~~~~~~~~~Yi~~~~eI~eVilSGGDPl~l~~~~L~~ll~~L~~  171 (352)
                      .-+.+|++|+..|+|||.+....+     .....++.+++.+.++.+.+. .+..|.+|||+|++..+  +.+++.....
T Consensus        14 l~ieiT~~CNlrC~~C~~~~~~~~~~~~~~~~~~ls~e~~~~li~~~~~~-g~~~v~~~GGEp~l~~~--~~e~i~~~~~   90 (327)
T d1tv8a_          14 LRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAEL-GVKKIRITGGEPLMRRD--LDVLIAKLNQ   90 (327)
T ss_dssp             EEEECCSCCSCCCTTTSCTTTSSTTCCCCCGGGSCCHHHHHHHHHHHHHT-TCCEEEEESSCGGGSTT--HHHHHHHHTT
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-CCEEEEECCCCCCCCCC--HHHHHHHHHH
T ss_conf             79972210089694789760167777647721459999999999999875-98389737986124664--7999998754


Q ss_pred             CCCCEEEEEECCEEEEEHHHCCHHHHHHHHHCCCCEEEEECCCCHHH-C----------CHHHHHHHHHHHHCCCEEEEC
Q ss_conf             99812898743435634343399999998625993899933699588-6----------999999999999879898232
Q gi|254781065|r  172 IKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYE-F----------SEEAIAAISRLANAGIILLSQ  240 (352)
Q Consensus       172 i~hv~~IRi~TR~pv~~P~Rit~~L~~~l~~~~~~~~iv~H~NHp~E-l----------t~~~~~A~~~L~~~Gv~v~nQ  240 (352)
                      ...+..+-+.|-.      .++++.++.|.+.+. -++.+.+.-.++ .          -..+..+++.+.++|+.+.-.
T Consensus        91 ~~~~~~~~~Tng~------ll~~~~~~~l~~~g~-~~i~iSldg~~~e~~~~~rg~~g~~~~~~~~~~~~~~~g~~~~~~  163 (327)
T d1tv8a_          91 IDGIEDIGLTTNG------LLLKKHGQKLYDAGL-RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVN  163 (327)
T ss_dssp             CTTCCEEEEEECS------TTHHHHHHHHHHHTC-CEEEEECCCSSHHHHHHHHSSCCCHHHHHHHHHHHHHTTCEEEEE
T ss_pred             HCCCCCCCCCCCC------CCCHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHEEECCCCCHHHHHHHHHHHCCCCCCEE
T ss_conf             2122201344431------112067999998399-878620256878776451020354211236899999859986325


Q ss_pred             HHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCC---CCCCCCHHHHHHHHHHH
Q ss_conf             7986234578899999999999869824230113457652---10118699999999999
Q gi|254781065|r  241 SVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGT---SHFRLTIEEGQKIVASL  297 (352)
Q Consensus       241 sVLLkgVND~~~~l~~L~~~L~~~gV~PYYl~~~d~v~G~---~hf~v~~~~~~~i~~~l  297 (352)
                      +++.+|.|.+..  .++.+.+...++...++-......+.   .....+.++.....+..
T Consensus       164 ~~v~~~~n~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (327)
T d1tv8a_         164 VVIQKGINDDQI--IPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQH  221 (327)
T ss_dssp             EEECTTTTGGGH--HHHHHHHHHTTCCEEEEECCCBCSSSSBCCSSCCCHHHHHHHHHHH
T ss_pred             EEEECCCCCCCC--HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             898568353100--8999999740654101353114675543322344288888888875



>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 352 L-lysine 2,3-aminomutase protein [Candidatus Liber
2a5h_A_95-342248 (A:95-342) L-lysine 2,3-aminomutase; radical SAM, 8e-28
1tv8_A_1-313313 (A:1-313) MOAA, molybdenum cofactor biosynthesis p 2e-14
3c8f_A_245 (A:) Pyruvate formate-lyase 1-activating enzyme; a 2e-08
2yx0_A_342 (A:) Radical SAM enzyme; predicted tRNA modificati 3e-05
1olt_A_1-364364 (A:1-364) Oxygen-independent coproporphyrinogen II 2e-04
1r30_A_369 (A:) Biotin synthase; SAM radical protein, TIM bar 1e-04
3can_A_182 (A:) Pyruvate-formate lyase-activating enzyme; str 0.002
>2a5h_A (A:95-342) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale}Length = 248 Back     alignment and structure
 Score =  119 bits (297), Expect = 8e-28
 Identities = 101/248 (40%), Positives = 154/248 (62%), Gaps = 2/248 (0%)

Query: 75  EDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAA 134
           EDP+ ++  SP+ G+ HRYPDR+LL +   C  YCR C RR   G         +  + A
Sbjct: 1   EDPLHEDTDSPVPGLTHRYPDRVLLLITDXCSXYCRHCTRRRFAGQSDD-SXPXERIDKA 59

Query: 135 LAYIQEKSQIWEVIFTGGDPLILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINP 194
           + YI+   Q+ +V+ +GGD L++S + L+ ++  LR I HV+I+R  SR P+V PQRI P
Sbjct: 60  IDYIRNTPQVRDVLLSGGDALLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQRITP 119

Query: 195 ELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAGIILLSQSVLLKGINDDPEIL 254
           EL+  LK+   PV++  H NHP E +EE+  A   LA+AG+ L +QSVLL+G+ND   + 
Sbjct: 120 ELVNXLKKY-HPVWLNTHFNHPNEITEESTRACQLLADAGVPLGNQSVLLRGVNDCVHVX 178

Query: 255 ANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLP 314
             L+   V++R++PYY++  DL+ G  HFR  + +G +I+  L+   SG C P +++D P
Sbjct: 179 KELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEGLRGHTSGYCVPTFVVDAP 238

Query: 315 GGYGKVKI 322
           GG GK  +
Sbjct: 239 GGGGKTPV 246


>1tv8_A (A:1-313) MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus}Length = 313 Back     alignment and structure
>3c8f_A (A:) Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*Length = 245 Back     alignment and structure
>2yx0_A (A:) Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii}Length = 342 Back     alignment and structure
>1olt_A (A:1-364) Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli}Length = 364 Back     alignment and structure
>1r30_A (A:) Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli}Length = 369 Back     alignment and structure
>3can_A (A:) Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482}Length = 182 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target352 L-lysine 2,3-aminomutase protein [Candidatus Liberibact
2a5h_A_95-342248 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 99.95
1tv8_A_1-313313 MOAA, molybdenum cofactor biosynthesis protein A; 99.54
3iix_A_348 Biotin synthetase, putative; adoMet radical, SAM r 99.28
1r30_A_369 Biotin synthase; SAM radical protein, TIM barrel, 99.03
2yx0_A_342 Radical SAM enzyme; predicted tRNA modification en 98.88
2z2u_A_311 UPF0026 protein MJ0257; metal binding protein; 2.4 98.46
3c8f_A_245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.31
1olt_A_1-364364 Oxygen-independent coproporphyrinogen III oxidase; 99.12
3can_A_182 Pyruvate-formate lyase-activating enzyme; structur 98.31
2qgq_A_1-112112 Protein TM_1862; alpha-beta protein, structural ge 98.24
2a5h_A_343-37836 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 94.58
>2a5h_A (A:95-342) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
Probab=99.95  E-value=3.9e-26  Score=205.30  Aligned_cols=248  Identities=41%  Similarity=0.800  Sum_probs=234.2

Q ss_pred             CCCCCCCCCCCCCCCEEECCCEEEEEECCCCCCHHHCCCCCCEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCC
Q ss_conf             37310000076887145207537999727430000011223301255556789899999999997299747999726981
Q gi|254781065|r   75 EDPIGDNNHSPLKGIVHRYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYIQEKSQIWEVIFTGGDP  154 (352)
Q Consensus        75 ~DPl~E~~~~p~pgl~hkY~~rvLl~~t~~C~~~CryCfR~~~~~~~~~~~~~~~~~~~~~~Yi~~~~eI~eVilSGGDP  154 (352)
                      .||+.|....|+++..|+|+.++.+.+|..|+..|+||+++...+.. ....+.+.+.+++..++....+++|++|||+|
T Consensus         1 ~D~l~e~~~~~~~~~~~~~~~~~~i~~T~~Cn~~C~~C~~~~~~~~~-~~~~~~e~i~~~~~~~~~~~~~~~i~~~ggep   79 (248)
T 2a5h_A            1 EDPLHEDTDSPVPGLTHRYPDRVLLLITDXCSXYCRHCTRRRFAGQS-DDSXPXERIDKAIDYIRNTPQVRDVLLSGGDA   79 (248)
T ss_dssp             SSTTCTTTSCSBTTEECCSSSEEEEEEESCCSSCCTTCTTTTTTTSS-SSBCCHHHHHHHHHHHHTCTTCCEEEEEESCT
T ss_pred             CCCCCCCCCCCCCCCEEECCCEEEEEECCCCCEECCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             47653111356887313337547998414301004512542335763-34214999999999998389836999856985


Q ss_pred             CCCCHHHHHHHHHHHHCCCCCEEEEEECCEEEEEHHHCCHHHHHHHHHCCCCEEEEECCCCHHHCCHHHHHHHHHHHHCC
Q ss_conf             32498999999999861998128987434356343433999999986259938999336995886999999999999879
Q gi|254781065|r  155 LILSHKRLQKVLKTLRYIKHVQILRFHSRVPIVDPQRINPELIQCLKEAGKPVYIAIHANHPYEFSEEAIAAISRLANAG  234 (352)
Q Consensus       155 l~l~~~~L~~ll~~L~~i~hv~~IRi~TR~pv~~P~Rit~~L~~~l~~~~~~~~iv~H~NHp~Elt~~~~~A~~~L~~~G  234 (352)
                      ++.+...+.+++..+.+..+...+++.|......++++...+...+.... -..-..+..+-........+++++++++|
T Consensus        80 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~-~~~~~~~~~~~~~~~~~~~~~i~~l~~~~  158 (248)
T 2a5h_A           80 LLVSDETLEYIIAKLREIPHVEIVRIGSRTPVVLPQRITPELVNXLKKYH-PVWLNTHFNHPNEITEESTRACQLLADAG  158 (248)
T ss_dssp             TSSCHHHHHHHHHHHHTSTTCCEEEEECSHHHHCGGGCCHHHHHHHGGGC-SEEEEECCCSGGGCCHHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCC-EEEEEEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             62688999999999970899754888705542461656899998530266-48997214765443034899999999779


Q ss_pred             CEEEECHHHHHCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEECC
Q ss_conf             89823279862345788999999999998698242301134576521011869999999999998288865410663178
Q gi|254781065|r  235 IILLSQSVLLKGINDDPEILANLMRTFVELRIKPYYLHHPDLAAGTSHFRLTIEEGQKIVASLKEKISGLCQPFYILDLP  314 (352)
Q Consensus       235 v~v~nQsVLLkgVND~~~~l~~L~~~L~~~gV~PYYl~~~d~v~G~~hf~v~~~~~~~i~~~l~~~lsG~~~P~~v~d~p  314 (352)
                      ..+.-.++++.|.||+.+.+.++.+.+.++|+.+.+++...+.+|+.++..+.....++++.+...++++..+.++.+++
T Consensus       159 ~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~v~i~~~~p~~~t~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~  238 (248)
T 2a5h_A          159 VPLGNQSVLLRGVNDCVHVXKELVNKLVKIRVRPYYIYQCDLSLGLEHFRTPVSKGIEIIEGLRGHTSGYCVPTFVVDAP  238 (248)
T ss_dssp             CCEEEEEECCTTTTCSHHHHHHHHHHHHHTTEEEEEEECCCCBTTCGGGCCCHHHHHHHHHTTBTTBCGGGCCEEEEEET
T ss_pred             CEEEEECEEECCCCCCHHHHHHHHHHHHHCCEEEEEEEECCCCCCHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             86987461678615877899999999984883899976126775232037889999999998775389744303764168


Q ss_pred             CCCCCEEECC
Q ss_conf             8888235551
Q gi|254781065|r  315 GGYGKVKIDT  324 (352)
Q Consensus       315 ~~~GKv~i~~  324 (352)
                      ++.||++|.|
T Consensus       239 ~~~G~l~i~p  248 (248)
T 2a5h_A          239 GGGGKTPVXP  248 (248)
T ss_dssp             TTTEEEECCC
T ss_pred             CCCCCCCCCC
T ss_conf             8988500566



>1tv8_A (A:1-313) MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} Back     alignment and structure
>3iix_A (A:) Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1r30_A (A:) Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} Back     alignment and structure
>2yx0_A (A:) Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>2z2u_A (A:) UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c8f_A (A:) Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>1olt_A (A:1-364) Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4S cluster; HET: SAM; 2.07A {Escherichia coli} Back     alignment and structure
>3can_A (A:) Pyruvate-formate lyase-activating enzyme; structural genomics, PSI, MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2qgq_A (A:1-112) Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>2a5h_A (A:343-378) L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, S-adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure