254781066

254781066

putative lysyl-tRNA synthetase protein

GeneID in NCBI database:8210089Locus tag:CLIBASIA_04840
Protein GI in NCBI database:254781066Protein Accession:YP_003065479.1
Gene range:-(1069696, 1070763)Protein Length:355aa
Gene description:putative lysyl-tRNA synthetase protein
COG prediction:[J] Truncated, possibly inactive, lysyl-tRNA synthetase (class II)
KEGG prediction:putative lysyl-tRNA synthetase protein; K04568 lysyl-tRNA synthetase, class II [EC:6.1.1.6]
SEED prediction:Lysyl-tRNA synthetase-related protein
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQEEI
cccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHcccEEEccccEEcccccccccccccccccccccccccEEEcccHHHHHHHHHHcccccEEEEEEEEcccccccccccccEEEEEHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccEEEEEEEEEccEEEcccHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEccHHHHHHHHcccccHHHHccccccccccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccEccccccccccHHHHHHHcHHHHHHHHEEccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccEEEccccccHHEHHHHHHHHHcccccHHHccHccHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccEEcccccEEcHHHccccccccccccEEEEEccHHHHcccHccccHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHccccccccccHHHHHHHHcccccHHHEEEccccccccccc
mhqipsqpwwnrdfhyrrrpflLKRNMIQSSLREYFVENQFieidsmslqyspgnethIRAFSTELIIQdhirkplylqtspefSCKKLLAAGEEKIFCFAHAwrngeqgclhqpeftmLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSfqnvncnpfsepeYITVAEAFARYAnidlgttldnpdqpdrHLLYLQAQQAGirvahddtWSDIFSRILIEkiepnlgincctildrypapesalaniypadprftKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKiynetypidEDFLACLTempqssgiamgFDRLVMLVTGannineviwtpfsqsnqeei
mhqipsqpwwnrdfhYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNineviwtpfsqsnqeei
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQEEI
**QIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTP**Q******
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPF********
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQEEI
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQEEI
MHQIPSQPWWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQSNQEEI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target355 putative lysyl-tRNA synthetase protein [Candidatus Libe
254781118502 lysyl-tRNA synthetase [Candidatus Liberibacter asi 2e-36
254780419622 aspartyl-tRNA synthetase [Candidatus Liberibacter 1e-05
>gi|254781118|ref|YP_003065531.1| lysyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Back     alignment
 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 168/332 (50%), Gaps = 28/332 (8%)

Query: 24  KRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPE 83
           +R+++ S +R +  +  F+E+++  LQ   G  T    F T     + ++  +YL+ +PE
Sbjct: 178 QRSLLISQIRHFMEKKGFMEVETPILQPIYGGAT-ADPFKTH---HNILKADMYLRIAPE 233

Query: 84  FSCKKLLAAG-EEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRC 142
              K++L +G  +++F     +RN      H PEFTM+E Y A+  Y  +MK   ++   
Sbjct: 234 LYLKRVLISGLTDQVFELNRNFRNEGVSSRHNPEFTMIEAYWAYTDYRDMMKLVEDLCHN 293

Query: 143 AAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDL---GTTLD----NPDQPDRH 195
            A+       +       PF E + I+    FA  + + L    T LD      DQ  R 
Sbjct: 294 LAK-------TLHGTTDIPFGE-KVISFKAPFACKSMLQLVKEATGLDFMLLKSDQEAR- 344

Query: 196 LLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPAD 255
              + AQ  GI V +D  W ++   I  EKIE N+ +N   I D +P   S  A     +
Sbjct: 345 ---VAAQSIGITVENDALWGEVMMTIFEEKIEKNI-VNPTHITD-FPKDISPFAKEVAGE 399

Query: 256 PRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLT- 314
            R  +RFE Y    E+CNA  EL DP+EQR R E+++++  +   E   +DEDFL  +T 
Sbjct: 400 KRLVERFETYCNGWEICNAFSELNDPVEQRIRMEQQVEQSHQ-RGEHTILDEDFLDAMTY 458

Query: 315 EMPQSSGIAMGFDRLVMLVTGANNINEVIWTP 346
            MP +SG+ +G DRL+ML+T A +I +VI  P
Sbjct: 459 GMPPASGLGLGIDRLIMLLTNAPSIRDVILFP 490

>gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Back     alignment
 Score = 42.4 bits (98), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%)

Query: 316 MPQSSGIAMGFDRLVMLVTGANNINEVIWTPFSQS 350
           MP   GIA G DR+VML+ GA N+ EV   P SQ+
Sbjct: 533 MPPHGGIAAGIDRIVMLLLGAKNVREVSLFPMSQN 567

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target355 putative lysyl-tRNA synthetase protein [Candidatus Libe
315122589352 putative lysyl-tRNA synthetase protein [Candidatus Libe 1 1e-167
227824115350 lysyl-tRNA synthetase protein [Sinorhizobium fredii NGR 1 1e-121
15964029350 putative lysyl-tRNA synthetase protein [Sinorhizobium m 1 1e-117
325293925354 lysyl-tRNA synthetase [Agrobacterium sp. H13-3] Length 1 1e-117
209551369353 lysine--tRNA ligase [Rhizobium leguminosarum bv. trifol 1 1e-116
116254325353 lysyl-tRNA synthetase-like protein [Rhizobium leguminos 1 1e-116
150398663350 lysine--tRNA ligase [Sinorhizobium medicae WSM419] Leng 1 1e-115
260464412348 Lysine--tRNA ligase [Mesorhizobium opportunistum WSM207 1 1e-115
327191735353 lysyl-tRNA synthetase protein [Rhizobium etli CNPAF512] 1 1e-115
218682608353 Lysine--tRNA ligase [Rhizobium etli CIAT 894] Length = 1 1e-115
>gi|315122589|ref|YP_004063078.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 352 Back     alignment and organism information
 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 278/349 (79%), Positives = 308/349 (88%), Gaps = 2/349 (0%)

Query: 1   MHQIPSQP--WWNRDFHYRRRPFLLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETH 58
           MH I S+   WWNRDFH+ RRPFL+KRNMIQ+SLREYF  N F+EIDSMSLQ SPGNETH
Sbjct: 1   MHSIASKSKSWWNRDFHHHRRPFLIKRNMIQTSLREYFFNNNFVEIDSMSLQVSPGNETH 60

Query: 59  IRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFT 118
           I+AFSTELI +DH RK +YLQTSPEFSCKKLLAAGEEKIFCFAH WRNGEQ  LHQPEFT
Sbjct: 61  IQAFSTELITKDHTRKIMYLQTSPEFSCKKLLAAGEEKIFCFAHVWRNGEQDSLHQPEFT 120

Query: 119 MLEWYRAHESYEQLMKDCMNIIRCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYA 178
           MLEWYRAHESYEQLM+DCM IIRCAAE A + +FSFQ + CNPFSE EYITV++AF RYA
Sbjct: 121 MLEWYRAHESYEQLMQDCMEIIRCAAEKAKKSVFSFQGITCNPFSEAEYITVSDAFLRYA 180

Query: 179 NIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKIEPNLGINCCTIL 238
           +IDL +TLD+   P+R+LL LQAQ++GIRVA+DDTWSDIFSRIL+EKIEP+LG+N CTIL
Sbjct: 181 HIDLCSTLDHSSPPNRNLLALQAQKSGIRVANDDTWSDIFSRILVEKIEPHLGVNRCTIL 240

Query: 239 DRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKI 298
           DRYP PESALA +   DPRFT+RFELYACNIELCNA DEL+DPIEQRHRFEKEM EKKKI
Sbjct: 241 DRYPLPESALAKVCSDDPRFTQRFELYACNIELCNAFDELIDPIEQRHRFEKEMNEKKKI 300

Query: 299 YNETYPIDEDFLACLTEMPQSSGIAMGFDRLVMLVTGANNINEVIWTPF 347
           YNETYPIDEDFLACL EMP SSGIAMGFDRLVML TGA N+NE+IWTPF
Sbjct: 301 YNETYPIDEDFLACLKEMPSSSGIAMGFDRLVMLATGATNLNEIIWTPF 349


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227824115|ref|YP_002828088.1| lysyl-tRNA synthetase protein [Sinorhizobium fredii NGR234] Length = 350 Back     alignment and organism information
>gi|15964029|ref|NP_384382.1| putative lysyl-tRNA synthetase protein [Sinorhizobium meliloti 1021] Length = 350 Back     alignment and organism information
>gi|325293925|ref|YP_004279789.1| lysyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 354 Back     alignment and organism information
>gi|209551369|ref|YP_002283286.1| lysine--tRNA ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 353 Back     alignment and organism information
>gi|116254325|ref|YP_770163.1| lysyl-tRNA synthetase-like protein [Rhizobium leguminosarum bv. viciae 3841] Length = 353 Back     alignment and organism information
>gi|150398663|ref|YP_001329130.1| lysine--tRNA ligase [Sinorhizobium medicae WSM419] Length = 350 Back     alignment and organism information
>gi|260464412|ref|ZP_05812603.1| Lysine--tRNA ligase [Mesorhizobium opportunistum WSM2075] Length = 348 Back     alignment and organism information
>gi|327191735|gb|EGE58737.1| lysyl-tRNA synthetase protein [Rhizobium etli CNPAF512] Length = 353 Back     alignment and organism information
>gi|218682608|ref|ZP_03530209.1| Lysine--tRNA ligase [Rhizobium etli CIAT 894] Length = 353 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 putative lysyl-tRNA synthetase protein [Candidatus Libe
TIGR00462304 TIGR00462, genX, lysyl-tRNA synthetase-like protein Gen 1e-109
PRK09350306 PRK09350, PRK09350, poxB regulator PoxA; Provisional 3e-64
pfam00152341 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K 6e-54
COG1190502 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Transl 1e-49
cd00775329 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class 8e-48
PRK00484491 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed 4e-46
TIGR00499496 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic 5e-43
KOG1885560 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class 2e-40
PRK029831094 PRK02983, lysS, lysyl-tRNA synthetase; Provisional 2e-36
PLN02502553 PLN02502, PLN02502, lysyl-tRNA synthetase 1e-34
PTZ00385659 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional 7e-31
PRK12445505 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed 1e-29
cd00669269 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA syntheta 2e-21
PTZ00417585 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional 4e-20
cd00776322 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) 5e-12
COG0017435 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [T 6e-11
TIGR00458428 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaea 6e-10
PRK05159437 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional 7e-06
KOG0554446 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase 2e-05
KOG0556533 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Tr 9e-05
TIGR00457453 TIGR00457, asnS, asparaginyl-tRNA synthetase 6e-04
COG2269322 COG2269, COG2269, Truncated, possibly inactive, lysyl-t 8e-98
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 1e-07
PRK00476588 PRK00476, aspS, aspartyl-tRNA synthetase; Validated 5e-06
COG0173585 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, r 7e-06
cd00777280 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class 5e-05
PRK03932450 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated 8e-05
PLN02903652 PLN02903, PLN02903, aminoacyl-tRNA ligase 4e-04
TIGR00459583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacteri 5e-05
KOG2411628 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mi 2e-04
TIGR00459 583 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacteri 2e-04
>gnl|CDD|161889 TIGR00462, genX, lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>gnl|CDD|181791 PRK09350, PRK09350, poxB regulator PoxA; Provisional Back     alignment and domain information
>gnl|CDD|143920 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|31383 COG1190, LysU, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29820 cd00775, LysRS_core, Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>gnl|CDD|179044 PRK00484, lysS, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|129590 TIGR00499, lysS_bact, lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|37096 KOG1885, KOG1885, KOG1885, Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179519 PRK02983, lysS, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178118 PLN02502, PLN02502, lysyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185588 PTZ00385, PTZ00385, lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|171504 PRK12445, PRK12445, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|58337 cd00669, Asp_Lys_Asn_RS_core, Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|173607 PTZ00417, PTZ00417, lysine-tRNA ligase; Provisional Back     alignment and domain information
>gnl|CDD|29821 cd00776, AsxRS_core, Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>gnl|CDD|30367 COG0017, AsnS, Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129550 TIGR00458, aspS_arch, aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>gnl|CDD|179948 PRK05159, aspC, aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|35774 KOG0554, KOG0554, KOG0554, Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35776 KOG0556, KOG0556, KOG0556, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161887 TIGR00457, asnS, asparaginyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|32450 COG2269, COG2269, Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|179042 PRK00476, aspS, aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|30522 COG0173, AspS, Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73228 cd00777, AspRS_core, Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>gnl|CDD|179678 PRK03932, asnC, asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178491 PLN02903, PLN02903, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>gnl|CDD|37622 KOG2411, KOG2411, KOG2411, Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129551 TIGR00459, aspS_bact, aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 355 putative lysyl-tRNA synthetase protein [Candidatus Libe
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 100.0
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 100.0
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 100.0
PRK12445505 lysyl-tRNA synthetase; Reviewed 100.0
KOG1885560 consensus 100.0
PRK09350325 lysyl-tRNA synthetase; Provisional 100.0
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 100.0
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 100.0
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 100.0
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 100.0
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 100.0
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 100.0
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 100.0
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 100.0
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 100.0
PRK06462332 asparagine synthetase A; Reviewed 100.0
TIGR00459653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 100.0
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 100.0
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 100.0
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 100.0
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 100.0
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 100.0
TIGR00458466 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 100.0
TIGR00499538 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 Th 100.0
KOG2411628 consensus 100.0
KOG0554446 consensus 100.0
KOG0556533 consensus 100.0
KOG0555545 consensus 100.0
PRK05425327 asparagine synthetase AsnA; Provisional 98.51
PTZ00213350 asparagine synthetase A; Provisional 98.08
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 99.57
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 99.52
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 99.51
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 99.46
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 99.44
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 99.39
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 99.18
CHL00201424 syh histidine-tRNA synthetase; Provisional 99.15
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.14
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.13
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 99.12
PRK12325438 prolyl-tRNA synthetase; Provisional 99.07
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 99.07
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 98.97
PRK12420421 histidyl-tRNA synthetase; Provisional 98.96
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 98.88
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.84
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 98.82
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 98.75
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 98.75
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 98.71
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 98.63
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 98.56
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 98.54
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 98.42
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 98.32
PRK03772642 threonyl-tRNA synthetase; Validated 98.21
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 98.14
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 98.1
PRK04483634 threonyl-tRNA synthetase; Validated 98.07
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 98.04
PRK12444639 threonyl-tRNA synthetase; Reviewed 98.0
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 97.92
TIGR00469460 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR00 97.88
PRK03991613 threonyl-tRNA synthetase; Validated 97.84
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 97.78
PRK08661478 prolyl-tRNA synthetase; Provisional 97.71
COG2502330 AsnA Asparagine synthetase A [Amino acid transport and 97.61
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 97.54
PRK09194 570 prolyl-tRNA synthetase; Provisional 97.38
PRK05431422 seryl-tRNA synthetase; Provisional 97.27
KOG2324457 consensus 97.12
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 96.78
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 96.25
KOG10351351 consensus 95.31
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 95.25
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core 94.56
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 94.31
KOG1936 518 consensus 94.16
PRK00252 864 alaS alanyl-tRNA synthetase; Reviewed 94.11
KOG2783436 consensus 93.94
KOG2509455 consensus 93.92
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 99.5
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 98.18
KOG2784483 consensus 97.69
PRK04173460 glycyl-tRNA synthetase; Provisional 97.64
PRK13902 898 alaS lanyl-tRNA synthetase; Provisional 93.76
COG0013 879 AlaS Alanyl-tRNA synthetase [Translation, ribosomal str 92.87
cd00645309 AsnA Asparagine synthetase (aspartate-ammonia ligase) ( 98.35
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 97.44
TIGR00389 606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 95.69
PRK09348291 glyQ glycyl-tRNA synthetase subunit alpha; Validated 93.41
COG0752298 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation 90.25
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 93.55
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 93.31
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 93.29
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>KOG0554 consensus Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>KOG0555 consensus Back     alignment and domain information
>PRK05425 asparagine synthetase AsnA; Provisional Back     alignment and domain information
>PTZ00213 asparagine synthetase A; Provisional Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR004530 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG2502 AsnA Asparagine synthetase A [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>PRK00252 alaS alanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2783 consensus Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0013 AlaS Alanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00645 AsnA Asparagine synthetase (aspartate-ammonia ligase) (AsnA) catalyses the conversion of L-aspartate to L-asparagine in the presence of ATP and ammonia Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09348 glyQ glycyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0752 GlyQ Glycyl-tRNA synthetase, alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target355 putative lysyl-tRNA synthetase protein [Candidatus Libe
3e9h_A493 Lysyl-Trna Synthetase From Bacillus Stearothermophi 1e-93
1lyl_A504 Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexe 3e-92
1bbu_A504 Lysyl-Trna Synthetase (Lyss) Complexed With Lysine 5e-92
3bju_A521 Crystal Structure Of Tetrameric Form Of Human Lysyl 1e-87
3a5y_A345 Crystal Structure Of Genx From Escherichia Coli In 2e-65
3g1z_A326 Structure Of Idp01693YJEA, A POTENTIAL T-Rna Synthe 2e-65
3a5z_A328 Crystal Structure Of Escherichia Coli Genx In Compl 2e-65
3nel_A438 Aspartyl-Trna Synthetase Complexed With Aspartic Ac 4e-43
1b8a_A438 Aspartyl-Trna Synthetase Length = 438 2e-42
1wyd_A429 Crystal Structure Of Aspartyl-Trna Synthetase From 3e-35
1eov_A487 Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.1 3e-35
1asy_A490 Class Ii Aminoacyl Transfer Rna Synthetases: Crysta 3e-35
3i7f_A548 Aspartyl Trna Synthetase From Entamoeba Histolytica 2e-34
1n9w_A422 Crystal Structure Of The Non-Discriminating And Arc 4e-31
3m4p_A456 Entamoeba Histolytica Asparaginyl-Trna Synthetase ( 3e-27
1x54_A434 Crystal Structure Of Asparaginyl-Trna Synthetase Fr 6e-26
1nnh_A294 Hypothetical Protein From Pyrococcus Furiosus Pfu-1 6e-05
2xti_A437 Asparaginyl-Trna Synthetase From Brugia Malayi Comp 2e-24
2xgt_A435 Asparaginyl-Trna Synthetase From Brugia Malayi Comp 2e-24
1eqr_A 590 Crystal Structure Of Free Aspartyl-Trna Synthetase 1e-23
1c0a_A 585 Crystal Structure Of The E. Coli Aspartyl-Trna Synt 1e-23
1eqr_A590 Crystal Structure Of Free Aspartyl-Trna Synthetase 1e-18
1c0a_A585 Crystal Structure Of The E. Coli Aspartyl-Trna Synt 1e-18
1efw_A580 Crystal Structure Of Aspartyl-Trna Synthetase From 9e-20
1efw_A 580 Crystal Structure Of Aspartyl-Trna Synthetase From 2e-17
2e3c_A291 Crystal Structure Of The Catalytic Domain Of Pyrrol 0.004
>gi|254220959|pdb|3E9H|A Chain A, Lysyl-Trna Synthetase From Bacillus Stearothermophilus Complexed With L-Lysylsulfamoyl Adenosine Length = 493 Back     alignment and structure
 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 103/366 (28%), Positives = 172/366 (46%), Gaps = 27/366 (7%)

Query: 1   MHQIPSQPWWNRD--FHYRRRP-----------FLLKRNMIQSSLREYFVENQFIEIDSM 47
           +  +P +    +D    YR+R              + R++I  S+R Y   + ++E+++ 
Sbjct: 140 LRPLPEKYHGLKDIEQRYRQRYLDLIMNPESKKTFITRSLIIQSMRRYLDSHGYLEVETP 199

Query: 48  SLQYSPGNETHIRAFSTELIIQDHIRKPLYLQTSPEFSCKKLLAAGEEKIFCFAHAWRNG 107
            +    G     R F T     + +   LY++ + E   K+L+  G EK++     +RN 
Sbjct: 200 MMHAVAGGAA-ARPFITH---HNALDMTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNE 255

Query: 108 EQGCLHQPEFTMLEWYRAHESYEQLMKDCMNIIRCAAE-VANQKIFSFQNVNCNPFSEPE 166
                H PEFTMLE Y A+  +  +MK   N+I   A  V       +     +   E  
Sbjct: 256 GISTRHNPEFTMLELYEAYADFRDIMKLTENLIAHIATEVLGTTKIQYGEHLVDLTPEWR 315

Query: 167 YITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQAQQAGIRVAHDDTWSDIFSRILIEKI 226
            + + +A   Y  +D    + +            A++ G+ VA   T+  I +    +K+
Sbjct: 316 RLHMVDAIKEYVGVDFWRQMSD------EEARELAKEHGVEVAPHMTFGHIVNEFFEQKV 369

Query: 227 EPNLGINCCTILDRYPAPESALANIYPADPRFTKRFELYACNIELCNACDELLDPIEQRH 286
           E    +   T +  +P   S LA   P DPRFT RFEL+    E  NA  EL DPI+QR 
Sbjct: 370 EDK--LIQPTFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDPIDQRQ 427

Query: 287 RFEKEMQEKKKIYNETYPIDEDFLACLT-EMPQSSGIAMGFDRLVMLVTGANNINEVIWT 345
           RFE++++E+++  +E + +DEDFL  L   MP + G+ +G DRLVML+T + +I +V+  
Sbjct: 428 RFEEQLKEREQGNDEAHEMDEDFLEALEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLF 487

Query: 346 PFSQSN 351
           P  +  
Sbjct: 488 PQMRHK 493


>gi|1311301|pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine Length = 504 Back     alignment and structure
>gi|11513774|pdb|1BBU|A Chain A, Lysyl-Trna Synthetase (Lyss) Complexed With Lysine Length = 504 Back     alignment and structure
>gi|167013425|pdb|3BJU|A Chain A, Crystal Structure Of Tetrameric Form Of Human Lysyl-Trna Synthetase Length = 521 Back     alignment and structure
>gi|304445705|pdb|3A5Y|A Chain A, Crystal Structure Of Genx From Escherichia Coli In Complex With Lysyladenylate Analog Length = 345 Back     alignment and structure
>gi|224983651|pdb|3G1Z|A Chain A, Structure Of Idp01693YJEA, A POTENTIAL T-Rna Synthetase From Salmonella Typhimurium Length = 326 Back     alignment and structure
>gi|304445709|pdb|3A5Z|A Chain A, Crystal Structure Of Escherichia Coli Genx In Complex With Elongation Factor P Length = 328 Back     alignment and structure
gi|302148834|pdb|3NEL|A Chain A, Aspartyl-Trna Synthetase Complexed With Aspartic Acid Length = 438 Back     alignment and structure
>gi|4388836|pdb|1B8A|A Chain A, Aspartyl-Trna Synthetase Length = 438 Back     alignment and structure
gi|110590680|pdb|1WYD|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Sulfolobus Tokodaii Length = 429 Back     alignment and structure
>gi|10835611|pdb|1EOV|A Chain A, Free Aspartyl-Trna Synthetase (Asprs) (E.C. 6.1.1.12) From Yeast Length = 487 Back     alignment and structure
>gi|1064982|pdb|1ASY|A Chain A, Class Ii Aminoacyl Transfer Rna Synthetases: Crystal Structure Of Yeast Aspartyl-Trna Synthetase Complexed With Trna Asp Length = 490 Back     alignment and structure
>gi|254575085|pdb|3I7F|A Chain A, Aspartyl Trna Synthetase From Entamoeba Histolytica Length = 548 Back     alignment and structure
gi|30749602|pdb|1N9W|A Chain A, Crystal Structure Of The Non-Discriminating And Archaeal- Type Aspartyl-Trna Synthetase From Thermus Thermophilus Length = 422 Back     alignment and structure
>gi|291463763|pdb|3M4P|A Chain A, Entamoeba Histolytica Asparaginyl-Trna Synthetase (Asnrs) In Complex With Asparaginyl-Adenylate Length = 456 Back     alignment and structure
gi|109156926|pdb|1X54|A Chain A, Crystal Structure Of Asparaginyl-Trna Synthetase From Pyrococcus Horikoshii Complexed With Asparaginyl-Adenylate Length = 434 Back     alignment and structure
gi|42543102|pdb|1NNH|A Chain A, Hypothetical Protein From Pyrococcus Furiosus Pfu-1801964 Length = 294 Back     alignment and structure
>gi|315113222|pdb|2XTI|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed With Atp:mg And L-Asp-Beta-Noh Adenylate:ppi:mg Length = 437 Back     alignment and structure
>gi|315113190|pdb|2XGT|A Chain A, Asparaginyl-Trna Synthetase From Brugia Malayi Complexed With The Sulphamoyl Analogue Of Asparaginyl-Adenylate Length = 435 Back     alignment and structure
gi|9256904|pdb|1EQR|A Chain A, Crystal Structure Of Free Aspartyl-Trna Synthetase From Escherichia Coli Length = 590 Back     alignment and structure
>gi|6573338|pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex Length = 585 Back     alignment and structure
gi|9256904|pdb|1EQR|A Chain A, Crystal Structure Of Free Aspartyl-Trna Synthetase From Escherichia Coli Length = 590 Back     alignment and structure
>gi|6573338|pdb|1C0A|A Chain A, Crystal Structure Of The E. Coli Aspartyl-Trna Synthetase : Trnaasp : Aspartyl-Adenylate Complex Length = 585 Back     alignment and structure
gi|9257069|pdb|1EFW|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Thermus Thermophilus Complexed To Trnaasp From Escherichia Coli Length = 580 Back     alignment and structure
gi|9257069|pdb|1EFW|A Chain A, Crystal Structure Of Aspartyl-Trna Synthetase From Thermus Thermophilus Complexed To Trnaasp From Escherichia Coli Length = 580 Back     alignment and structure
>gi|162329880|pdb|2E3C|A Chain A, Crystal Structure Of The Catalytic Domain Of Pyrrolysyl- Trna Synthetase Length = 291 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target355 putative lysyl-tRNA synthetase protein [Candidatus Libe
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA sy 4e-56
1e1o_A504 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetas 2e-55
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 3e-55
3e9h_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 6e-53
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthet 9e-43
3g1z_A326 Putative lysyl-tRNA synthetase; drug target, nucleotide 5e-42
3bju_A521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- 2e-34
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding 5e-33
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligas 7e-27
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoac 1e-25
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; structural 4e-25
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A 7e-22
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, ligase; 8e-22
1b8a_A438 Protein (aspartyl-tRNA synthetase); tRNA ligase,; HET: 2e-18
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, 4e-16
1l0w_A580 Aspartyl-tRNA synthetase; space-grown crystal, dimeric 2e-16
1c0a_A585 Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU 3e-16
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dimeric 2e-12
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU 3e-10
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 6e-15
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 1e-09
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Length = 345 Back     alignment and structure
 Score =  213 bits (544), Expect = 4e-56
 Identities = 104/330 (31%), Positives = 160/330 (48%), Gaps = 29/330 (8%)

Query: 22  LLKRNMIQSSLREYFVENQFIEIDSMSLQYSPGNETHIRAFSTELIIQDHIR-KPLYLQT 80
           LLKR  I + +R +F +   +E+++  +  +   + H+  F T  +   H +   L+L T
Sbjct: 36  LLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGPGHSQGMNLWLMT 95

Query: 81  SPEFSCKKLLAAGEEKIFCFAHAWRNGEQGCLHQPEFTMLEWYRAHESYEQLMKDCMNII 140
           SPE+  K+LL AG   +F    ++RN E G  H PEFTMLEWYR H    +LM +  +++
Sbjct: 96  SPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDLL 155

Query: 141 RCAAEVANQKIFSFQNVNCNPFSEPEYITVAEAFARYANIDLGTTLDNPDQPDRHLLYLQ 200
           +                        E ++  +AF RY  ID       P   D+  L   
Sbjct: 156 Q----------------QVLDCPAAESLSYQQAFLRYLEID-------PLSADKTQLREV 192

Query: 201 AQQAGIRVAHDDTWS--DIFSRILIEKIEPNLGINCCTILDRYPAPESALANIYPADPRF 258
           A +  +    D       +   +    +EPN+G    T +  +PA +++LA I   D R 
Sbjct: 193 AAKLDLSNVADTEEDRDTLLQLLFTFGVEPNIGKEKPTFVYHFPASQASLAQISTEDHRV 252

Query: 259 TKRFELYACNIELCNACDELLDPIEQRHRFEKEMQEKKKIYNETYPIDEDFLACLTE-MP 317
            +RFE+Y   IEL N   EL D  EQ+ RFE++ +++       +PID++ +  L   MP
Sbjct: 253 AERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQHPIDQNLIEALKVGMP 312

Query: 318 QSSGIAMGFDRLVMLVTGANNINEVIWTPF 347
             SG+A+G DRLVML  GA  + EVI   F
Sbjct: 313 DCSGVALGVDRLVMLALGAETLAEVI--AF 340


>1e1o_A Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Length = 504 Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Length = 493 Back     alignment and structure
>3e9h_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm; HET: KAA; 2.10A {Bacillus stearothermophilus} PDB: 3e9i_A* Length = 493 Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Length = 487 Back     alignment and structure
>3g1z_A Putative lysyl-tRNA synthetase; drug target, nucleotide, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: AMP; 1.95A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Length = 521 Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Length = 548 Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Length = 438 Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Length = 456 Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 Length = 294 Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 Length = 422 Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, ligase; HET: EPE; 2.30A {Sulfolobus tokodaii str} Length = 429 Back     alignment and structure
>1b8a_A Protein (aspartyl-tRNA synthetase); tRNA ligase,; HET: ATP; 1.90A {Pyrococcus kodakaraensis} SCOP: b.40.4.1 d.104.1.1 Length = 438 Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Length = 434 Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Length = 580 Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585 Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Length = 580 Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Length = 585 Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Length = 291 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Length = 288 Back     alignment and structure