254781067

254781067

elongation factor P

GeneID in NCBI database:8210090Locus tag:CLIBASIA_04845
Protein GI in NCBI database:254781067Protein Accession:YP_003065480.1
Gene range:+(1070924, 1071493)Protein Length:189aa
Gene description:elongation factor P
COG prediction:[J] Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)
KEGG prediction:efp; elongation factor P; K02356 elongation factor EF-P
SEED prediction:Translation elongation factor P
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation elongation factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK
ccEEEHHHcccccEEEEccEEEEEEEEEEEcccccccEEEEEEEEcccccEEEEEEcccccEEEEEEEEEEEEEEEccccEEEEcccccccEEEEcHHHHccHHHccccccEEEEEEEccEEEEEEcccEEEEEEEEcccccccEEcccccccEEEEcccEEEcccccccccEEEEEcccccEEHHccc
ccEEEcccccccEEEEEccccEEEEEEEEcccccccHHHHHHHHHcccccEEEEcccccccccccEEEcccEEEEEccccEEEEcccccccHccccHHHHHHHHHHHHHccEEEEEEEcccEEEEccccEEEEEEEEccccccccccccccccEEEEccEEEEEEEEEEcccEEEEEcccccEEEEccc
MVKVIASAVRkgnvldvdGKLYIVLVAKnfhpgkgtpitqVEMRRISdgvkvsnrwRTTEQVERAFVEDQRfqflyqdqegfhfmnpetydqvtvseevigDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVidtepsskgqtvtasykpailsndirttvpphinigddiviltednsyVERVKK
MVKVIAsavrkgnvldvdgKLYIVLVAknfhpgkgtpitqvemrrisdgvkvsnrwrttEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVidtepsskgqtvtasykpailsndirttvpphinigddiviltednsyvervkk
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK
***VIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERV**
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTE********TASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK
*VKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVER***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK
MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERVKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target189 elongation factor P [Candidatus Liberibacter asiaticus
315122588189 elongation factor P [Candidatus Liberibacter solanacear 1 5e-97
327191736294 elongation factor protein [Rhizobium etli CNPAF512] Len 1 1e-79
86359619189 elongation factor P [Rhizobium etli CFN 42] Length = 18 1 1e-79
190893893189 elongation factor protein [Rhizobium etli CIAT 652] Len 1 3e-79
218674353189 elongation factor P [Rhizobium etli GR56] Length = 189 1 5e-78
15889812189 elongation factor P [Agrobacterium tumefaciens str. C58 1 5e-78
325293924189 elongation factor P [Agrobacterium sp. H13-3] Length = 1 8e-78
209551370189 elongation factor P [Rhizobium leguminosarum bv. trifol 1 9e-78
116254326189 elongation factor P [Rhizobium leguminosarum bv. viciae 1 1e-77
241206812189 elongation factor P [Rhizobium leguminosarum bv. trifol 1 2e-77
>gi|315122588|ref|YP_004063077.1| elongation factor P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 189 Back     alignment and organism information
 Score =  357 bits (915), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 182/189 (96%)

Query: 1   MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTE 60
           MVKVIASAVRKGNVLDV+G+LY+VLVAKNF+PGKGTPITQVEMRRISDGVKVS RWRTTE
Sbjct: 1   MVKVIASAVRKGNVLDVNGRLYVVLVAKNFYPGKGTPITQVEMRRISDGVKVSERWRTTE 60

Query: 61  QVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEG 120
           QVERAFVEDQRFQFLY D EG+HFMNPE YDQVTVS +V+GDQKVYFQEGMEVKLLIHEG
Sbjct: 61  QVERAFVEDQRFQFLYADHEGYHFMNPENYDQVTVSIDVVGDQKVYFQEGMEVKLLIHEG 120

Query: 121 VALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTED 180
           VALSVEVPRHV+F V+DTEPS+KGQTVT SYKPAILSNDIRTTVPPHINIGD+IVILTED
Sbjct: 121 VALSVEVPRHVIFKVVDTEPSAKGQTVTTSYKPAILSNDIRTTVPPHINIGDEIVILTED 180

Query: 181 NSYVERVKK 189
           NSYVERVKK
Sbjct: 181 NSYVERVKK 189


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327191736|gb|EGE58738.1| elongation factor protein [Rhizobium etli CNPAF512] Length = 294 Back     alignment and organism information
>gi|86359619|ref|YP_471511.1| elongation factor P [Rhizobium etli CFN 42] Length = 189 Back     alignment and organism information
>gi|190893893|ref|YP_001980435.1| elongation factor protein [Rhizobium etli CIAT 652] Length = 189 Back     alignment and organism information
>gi|218674353|ref|ZP_03524022.1| elongation factor P [Rhizobium etli GR56] Length = 189 Back     alignment and organism information
>gi|15889812|ref|NP_355493.1| elongation factor P [Agrobacterium tumefaciens str. C58] Length = 189 Back     alignment and organism information
>gi|325293924|ref|YP_004279788.1| elongation factor P [Agrobacterium sp. H13-3] Length = 189 Back     alignment and organism information
>gi|209551370|ref|YP_002283287.1| elongation factor P [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 189 Back     alignment and organism information
>gi|116254326|ref|YP_770164.1| elongation factor P [Rhizobium leguminosarum bv. viciae 3841] Length = 189 Back     alignment and organism information
>gi|241206812|ref|YP_002977908.1| elongation factor P [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 189 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target189 elongation factor P [Candidatus Liberibacter asiaticus
PRK00529186 PRK00529, PRK00529, elongation factor P; Validated 3e-66
TIGR00038184 TIGR00038, efp, translation elongation factor P 5e-58
PRK04542189 PRK04542, PRK04542, elongation factor P; Provisional 8e-24
PRK12426185 PRK12426, PRK12426, elongation factor P; Provisional 9e-22
TIGR02178186 TIGR02178, yeiP, elongation factor P-like protein YeiP 5e-21
PRK14578187 PRK14578, PRK14578, elongation factor P; Provisional 2e-20
cd0447061 cd04470, S1_EF-P_repeat_1, S1_EF-P_repeat_1: Translatio 2e-16
pfam0113255 pfam01132, EFP, Elongation factor P (EF-P) OB domain 9e-16
pfam0928556 pfam09285, Elong-fact-P_C, Elongation factor P, C-termi 7e-15
smart0084156 smart00841, Elong-fact-P_C, Elongation factor P, C-term 1e-14
cd0579456 cd05794, S1_EF-P_repeat_2, S1_EF-P_repeat_2: Translatio 1e-12
pfam0820758 pfam08207, EFP_N, Elongation factor P (EF-P) KOW-like d 3e-10
COG0231131 COG0231, Efp, Translation elongation factor P (EF-P)/tr 8e-32
>gnl|CDD|179058 PRK00529, PRK00529, elongation factor P; Validated Back     alignment and domain information
>gnl|CDD|161673 TIGR00038, efp, translation elongation factor P Back     alignment and domain information
>gnl|CDD|179863 PRK04542, PRK04542, elongation factor P; Provisional Back     alignment and domain information
>gnl|CDD|183522 PRK12426, PRK12426, elongation factor P; Provisional Back     alignment and domain information
>gnl|CDD|131233 TIGR02178, yeiP, elongation factor P-like protein YeiP Back     alignment and domain information
>gnl|CDD|173042 PRK14578, PRK14578, elongation factor P; Provisional Back     alignment and domain information
>gnl|CDD|88435 cd04470, S1_EF-P_repeat_1, S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1 Back     alignment and domain information
>gnl|CDD|144650 pfam01132, EFP, Elongation factor P (EF-P) OB domain Back     alignment and domain information
>gnl|CDD|150075 pfam09285, Elong-fact-P_C, Elongation factor P, C-terminal Back     alignment and domain information
>gnl|CDD|129074 smart00841, Elong-fact-P_C, Elongation factor P, C-terminal Back     alignment and domain information
>gnl|CDD|88469 cd05794, S1_EF-P_repeat_2, S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1 Back     alignment and domain information
>gnl|CDD|149330 pfam08207, EFP_N, Elongation factor P (EF-P) KOW-like domain Back     alignment and domain information
>gnl|CDD|30580 COG0231, Efp, Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 189 elongation factor P [Candidatus Liberibacter asiaticus
TIGR00038194 efp translation elongation factor P; InterPro: IPR01176 100.0
PRK00529186 elongation factor P; Validated 100.0
PRK12426185 elongation factor P; Provisional 100.0
PRK04542189 elongation factor P; Provisional 100.0
TIGR02178187 yeiP elongation factor P-like protein YeiP; InterPro: I 100.0
COG0231131 Efp Translation elongation factor P (EF-P)/translation 100.0
PRK03999129 translation initiation factor IF-5A; Provisional 100.0
TIGR00037137 eIF_5A translation initiation factor eIF-5A; InterPro: 99.64
PTZ00328166 eukaryotic initiation factor 5a; Provisional 99.39
KOG3271156 consensus 99.19
COG1499355 NMD3 NMD protein affecting ribosome stability and mRNA 96.73
pfam0928556 Elong-fact-P_C Elongation factor P, C-terminal. Members 99.87
smart0084156 Elong-fact-P_C Elongation factor P, C-terminal. These n 99.87
cd0579456 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongati 99.86
cd0446355 S1_EF_like S1_EF_like: EF-like, S1-like RNA-binding dom 95.05
cd0447061 S1_EF-P_repeat_1 S1_EF-P_repeat_1: Translation elongati 99.8
pfam0113255 EFP Elongation factor P (EF-P) OB domain. 99.69
cd0446757 S1_aIF5A S1_aIF5A: Archaeal translation Initiation Fact 96.92
cd0446355 S1_EF_like S1_EF_like: EF-like, S1-like RNA-binding dom 96.01
pfam0128769 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-bi 92.57
pfam0820758 EFP_N Elongation factor P (EF-P) KOW-like domain. 99.72
>TIGR00038 efp translation elongation factor P; InterPro: IPR011768 Members of this family possess translation elongation factor activity Back     alignment and domain information
>PRK00529 elongation factor P; Validated Back     alignment and domain information
>PRK12426 elongation factor P; Provisional Back     alignment and domain information
>PRK04542 elongation factor P; Provisional Back     alignment and domain information
>TIGR02178 yeiP elongation factor P-like protein YeiP; InterPro: IPR011897 This entry represents homologs of elongation factor P (IPR011768 from INTERPRO) and probably are translation factors Back     alignment and domain information
>COG0231 Efp Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03999 translation initiation factor IF-5A; Provisional Back     alignment and domain information
>TIGR00037 eIF_5A translation initiation factor eIF-5A; InterPro: IPR001884 Translation initiation factor 5A (IF-5A) is reported to be involved in the first step of peptide bond formation in translation, to be involved in cell-cycle regulation and to be a cofactor for the Rev and Rex transactivator proteins of human immunodeficiency virus-1 and T-cell leukaemia virus I, respectively , , Back     alignment and domain information
>PTZ00328 eukaryotic initiation factor 5a; Provisional Back     alignment and domain information
>KOG3271 consensus Back     alignment and domain information
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam09285 Elong-fact-P_C Elongation factor P, C-terminal Back     alignment and domain information
>smart00841 Elong-fact-P_C Elongation factor P, C-terminal Back     alignment and domain information
>cd05794 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1 Back     alignment and domain information
>cd04463 S1_EF_like S1_EF_like: EF-like, S1-like RNA-binding domain Back     alignment and domain information
>cd04470 S1_EF-P_repeat_1 S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1 Back     alignment and domain information
>pfam01132 EFP Elongation factor P (EF-P) OB domain Back     alignment and domain information
>cd04467 S1_aIF5A S1_aIF5A: Archaeal translation Initiation Factor 5A (aIF5A), S1-like RNA-binding domain Back     alignment and domain information
>cd04463 S1_EF_like S1_EF_like: EF-like, S1-like RNA-binding domain Back     alignment and domain information
>pfam01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold Back     alignment and domain information
>pfam08207 EFP_N Elongation factor P (EF-P) KOW-like domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target189 elongation factor P [Candidatus Liberibacter asiaticus
3a5z_B191 Crystal Structure Of Escherichia Coli Genx In Compl 2e-58
1yby_A215 Conserved Hypothetical Protein Cth-95 From Clostrid 3e-58
1ueb_A184 Crystal Structure Of Translation Elongation Factor 1e-51
3oyy_A191 Structure Of Pseudomonas Aeruginosa Elongation Fact 1e-42
1bkb_A136 Initiation Factor 5a From Archebacterium Pyrobaculu 2e-07
1eif_A135 Eukaryotic Translation Initiation Factor 5a From Me 4e-07
2eif_A136 Eukaryotic Translation Initiation Factor 5a From Me 4e-07
1iz6_A138 Crystal Structure Of Translation Initiation Factor 2e-06
3hks_A167 Crystal Structure Of Eukaryotic Translation Initiat 9e-06
1xtd_A174 Structural Analysis Of Leishmania Mexicana Eukaryot 3e-04
1x6o_A174 Structural Analysis Of Leishmania Braziliensis Euka 4e-04
3cpf_A138 Crystal Structure Of Human Eukaryotic Translation I 0.003
>gi|304445710|pdb|3A5Z|B Chain B, Crystal Structure Of Escherichia Coli Genx In Complex With Elongation Factor P Length = 191 Back     alignment and structure
 Score =  229 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 63/188 (33%), Positives = 97/188 (51%)

Query: 1   MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTE 60
           M    ++  R G  + +DG+ Y V  ++   PGKG    +V++RR+  G +V   +++T+
Sbjct: 4   MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTD 63

Query: 61  QVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEG 120
             E A V D    +LY D E +HFMN ET++Q++   + IGD   +  +  E  + +  G
Sbjct: 64  SAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNG 123

Query: 121 VALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTED 180
             +SV  P  V   ++DT+P  KG T     KPA LS      VP  + IG+ I + T  
Sbjct: 124 QPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS 183

Query: 181 NSYVERVK 188
             YV RVK
Sbjct: 184 GEYVSRVK 191


>gi|60594226|pdb|1YBY|A Chain A, Conserved Hypothetical Protein Cth-95 From Clostridium Thermocellum Length = 215 Back     alignment and structure
gi|49259329|pdb|1UEB|A Chain A, Crystal Structure Of Translation Elongation Factor P From Thermus Thermophilus Hb8 Length = 184 Back     alignment and structure
>gi|325533964|pdb|3OYY|A Chain A, Structure Of Pseudomonas Aeruginosa Elongation Factor P Length = 191 Back     alignment and structure
>gi|157830360|pdb|1BKB|A Chain A, Initiation Factor 5a From Archebacterium Pyrobaculum Aerophilum Length = 136 Back     alignment and structure
>gi|157830953|pdb|1EIF|A Chain A, Eukaryotic Translation Initiation Factor 5a From Methanococcus Jannaschii Length = 135 Back     alignment and structure
>gi|6729830|pdb|2EIF|A Chain A, Eukaryotic Translation Initiation Factor 5a From Methanococcus Jannaschii Length = 136 Back     alignment and structure
gi|28373376|pdb|1IZ6|A Chain A, Crystal Structure Of Translation Initiation Factor 5a From Pyrococcus Horikoshii Length = 138 Back     alignment and structure
>gi|260099974|pdb|3HKS|A Chain A, Crystal Structure Of Eukaryotic Translation Initiation Factor Eif-5a2 From Arabidopsis Thaliana Length = 167 Back     alignment and structure
>gi|56554724|pdb|1XTD|A Chain A, Structural Analysis Of Leishmania Mexicana Eukaryotic Initiation Factor 5a Length = 174 Back     alignment and structure
>gi|52696276|pdb|1X6O|A Chain A, Structural Analysis Of Leishmania Braziliensis Eukaryotic Initiation Factor 5a Length = 174 Back     alignment and structure
>gi|183448388|pdb|3CPF|A Chain A, Crystal Structure Of Human Eukaryotic Translation Initiation Factor Eif5a Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target189 elongation factor P [Candidatus Liberibacter asiaticus
3a5z_B191 EF-P, elongation factor P; aminoacyl-tRNA synthetase pa 2e-51
1yby_A215 Translation elongation factor P; conserved hypothetical 1e-41
1ueb_A184 EF-P, TT0860, elongation factor P; beta barrel, riken s 2e-37
1iz6_A138 Initiation factor 5A; SH3-like barrel, OB fold, biosynt 1e-21
1bkb_A136 Translation initiation factor 5A; 1.75A {Pyrobaculum ae 4e-19
3er0_A167 Eukaryotic translation initiation factor 5A-2; yeast, l 2e-18
2eif_A136 IF-5A, protein (eukaryotic translation initiation facto 6e-18
3hks_A167 EIF-5A-2, eukaryotic translation initiation factor 5A-2 2e-16
3cpf_A138 Eukaryotic translation initiation factor 5A-1; structur 1e-15
1x6o_A174 Eukaryotic initiation factor 5A; SGPP, structural genom 1e-13
>3a5z_B EF-P, elongation factor P; aminoacyl-tRNA synthetase paralog, translation, tRNA, lysyl- synthetase, structural genomics, NPPSFA; HET: KAA; 2.50A {Escherichia coli} Length = 191 Back     alignment and structure
 Score =  196 bits (501), Expect = 2e-51
 Identities = 63/188 (33%), Positives = 97/188 (51%)

Query: 1   MVKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTE 60
           M    ++  R G  + +DG+ Y V  ++   PGKG    +V++RR+  G +V   +++T+
Sbjct: 4   MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTD 63

Query: 61  QVERAFVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEG 120
             E A V D    +LY D E +HFMN ET++Q++   + IGD   +  +  E  + +  G
Sbjct: 64  SAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNG 123

Query: 121 VALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTED 180
             +SV  P  V   ++DT+P  KG T     KPA LS      VP  + IG+ I + T  
Sbjct: 124 QPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS 183

Query: 181 NSYVERVK 188
             YV RVK
Sbjct: 184 GEYVSRVK 191


>1yby_A Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum} Length = 215 Back     alignment and structure
>1ueb_A EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus} SCOP: b.34.5.2 b.40.4.5 b.40.4.5 PDB: 3huw_V 3huy_V Length = 184 Back     alignment and structure
>1iz6_A Initiation factor 5A; SH3-like barrel, OB fold, biosynthetic protein; 2.00A {Pyrococcus horikoshii OT3} SCOP: b.34.5.2 b.40.4.5 Length = 138 Back     alignment and structure
>1bkb_A Translation initiation factor 5A; 1.75A {Pyrobaculum aerophilum} SCOP: b.34.5.2 b.40.4.5 Length = 136 Back     alignment and structure
>3er0_A Eukaryotic translation initiation factor 5A-2; yeast, low resolution, acetylation, hypusine, phosphoprotein, protein biosynthesis; 3.35A {Saccharomyces cerevisiae} Length = 167 Back     alignment and structure
>2eif_A IF-5A, protein (eukaryotic translation initiation factor 5A); EIF-5A, OB-fold, structural genomics; 1.80A {Methanocaldococcus jannaschii DSM2661} SCOP: b.34.5.2 b.40.4.5 PDB: 1eif_A Length = 136 Back     alignment and structure
>3hks_A EIF-5A-2, eukaryotic translation initiation factor 5A-2; beta barrel, alternative splicing, hypusine, protein biosynthesis; 2.30A {Arabidopsis thaliana} Length = 167 Back     alignment and structure
>3cpf_A Eukaryotic translation initiation factor 5A-1; structural genomics consortium, leukemia, apoptosis, SGC, acetylation, alternative splicing; 2.50A {Homo sapiens} Length = 138 Back     alignment and structure
>1x6o_A Eukaryotic initiation factor 5A; SGPP, structural genomics, PSI, protein structure initiative; 1.60A {Leishmania braziliensis} SCOP: b.34.5.2 b.40.4.5 PDB: 1xtd_A Length = 174 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 elongation factor P [Candidatus Liberibacter asiaticus
1yby_A215 Translation elongation factor P; conserved hypothetical 100.0
3a5z_B191 EF-P, elongation factor P; aminoacyl-tRNA synthetase pa 100.0
1ueb_A184 EF-P, TT0860, elongation factor P; beta barrel, riken s 100.0
1bkb_A136 Translation initiation factor 5A; 1.75A {Pyrobaculum ae 100.0
1iz6_A138 Initiation factor 5A; SH3-like barrel, OB fold, biosynt 100.0
2eif_A136 IF-5A, protein (eukaryotic translation initiation facto 100.0
3er0_A167 Eukaryotic translation initiation factor 5A-2; yeast, l 100.0
3cpf_A138 Eukaryotic translation initiation factor 5A-1; structur 100.0
3hks_A167 EIF-5A-2, eukaryotic translation initiation factor 5A-2 99.98
1x6o_A174 Eukaryotic initiation factor 5A; SGPP, structural genom 99.97
1khi_A176 HEX1; membrane sealing, peroxisomal target, structural 99.31
>1yby_A Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum} Back     alignment and structure
Probab=100.00  E-value=0  Score=484.88  Aligned_cols=186  Identities=32%  Similarity=0.604  Sum_probs=184.7

Q ss_pred             CEEEHHHCCCCCEEEECCEEEEEEEEEEECCCCCCCEEEEEEEECCCCCCEEEEECCCCCEEEEEECCCEEEEEEEECCE
Q ss_conf             23664321677589988937999998753688876389999998246871001342787200101056405789961988
Q gi|254781067|r    2 VKVIASAVRKGNVLDVDGKLYIVLVAKNFHPGKGTPITQVEMRRISDGVKVSNRWRTTEQVERAFVEDQRFQFLYQDQEG   81 (189)
Q Consensus         2 ~~i~an~lk~G~~i~~dg~~~~V~~~~~~kpgkg~a~v~~klknL~tG~~~e~~f~~~ekve~~~ie~~~~qylY~dg~~   81 (189)
                      ||++|||||+|++|++||+||+|++++|+|||||+|++|+|||||.||+++++||+++|++|.|+++++++||||.||+.
T Consensus        30 ~mi~a~dlkkG~~I~~dg~py~Vl~~~~~kpGkg~A~vr~KlKnL~tG~~~e~tf~s~ekve~a~le~~~~qyLY~Dg~~  109 (215)
T 1yby_A           30 LMISAGDFKNGVTFELDGQIFQVIEFQHVKPGKGAAFVRTKLKNIVTGATIEKTFNPTDKMPKAHIERKDMQYLYNDGDL  109 (215)
T ss_dssp             -CEEGGGCCTTCEEEETTEEEEEEEEEEECCC--CCEEEEEEEETTTCCEEEEEECTTCEECBCCCEEEEEEEEEEETTE
T ss_pred             EEEEHHHCCCCCEEEECCEEEEEEEEEEECCCCCCEEEEEEEEECCCCCCEEEEECCCCCEEECCEEEEEEEEEEECCCC
T ss_conf             34487876687899999999999998862499995289999998168983478974776110111343789999968998


Q ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECCEEEEECCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCE
Q ss_conf             99994688764321154300133201378615689766777440158749999998285421310247700089937959
Q gi|254781067|r   82 FHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSVEVPRHVVFTVIDTEPSSKGQTVTASYKPAILSNDIR  161 (189)
Q Consensus        82 ~~FMd~etyeqi~i~~~~ig~~~~fL~eg~~v~i~~~~~~~i~i~lP~~v~l~V~~t~p~~kG~t~~~~~K~A~letG~~  161 (189)
                      |+|||++||||++++++++|++.+||+||++|++++|+|+||+|+||++|+|+|++|+|++||||+++++|||+||||++
T Consensus       110 ~~FMd~etyEQi~v~~d~ig~~~~~L~e~~~v~v~~~~~~~i~v~lP~~V~l~V~et~p~vKGdTas~~~K~A~LeTG~~  189 (215)
T 1yby_A          110 YYFMDTETFEQLPLGKDKIGDALKFVKENEIVKVLSHKGNVFGIEPPNFVELEVTDTEPGFKGDTATGATKPAIVETGAS  189 (215)
T ss_dssp             EEEECTTTCCEEEEEHHHHTTTTTTCCTTCEEEEEEETTEEEEEECCSEEEEEEEEC-------CCSCCEEEEEETTSCE
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCEEEECCCCEEEEEEEECCCCCCCCCCCCCCCCEEEECCCE
T ss_conf             89873877543233366641466521468507999926842100148739999998999655654678877489818999


Q ss_pred             EECCCCCCCCCEEEEECCCCCEEHHC
Q ss_conf             98474016887999988997240210
Q gi|254781067|r  162 TTVPPHINIGDDIVILTEDNSYVERV  187 (189)
Q Consensus       162 i~VP~FI~~Gd~IkV~T~~g~Y~~Ra  187 (189)
                      |+||+||++||+|+|||++|+|++|+
T Consensus       190 v~VP~FI~~Gd~IkV~T~~g~Y~~RV  215 (215)
T 1yby_A          190 IKVPLFVNKGDIIRIDTRTGEYMERV  215 (215)
T ss_dssp             EEEETTCCTTCEEEEETTTTEEEEEC
T ss_pred             EEECCCCCCCCEEEEECCCCEEEECC
T ss_conf             98488327999999989987067059



>3a5z_B EF-P, elongation factor P; aminoacyl-tRNA synthetase paralog, translation, tRNA, lysyl- synthetase, structural genomics, NPPSFA; HET: KAA; 2.50A {Escherichia coli} Back     alignment and structure
>1ueb_A EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus} SCOP: b.34.5.2 b.40.4.5 b.40.4.5 PDB: 3huw_V 3huy_V Back     alignment and structure
>1bkb_A Translation initiation factor 5A; 1.75A {Pyrobaculum aerophilum} SCOP: b.34.5.2 b.40.4.5 Back     alignment and structure
>1iz6_A Initiation factor 5A; SH3-like barrel, OB fold, biosynthetic protein; 2.00A {Pyrococcus horikoshii OT3} SCOP: b.34.5.2 b.40.4.5 Back     alignment and structure
>2eif_A IF-5A, protein (eukaryotic translation initiation factor 5A); EIF-5A, OB-fold, structural genomics; 1.80A {Methanocaldococcus jannaschii DSM2661} SCOP: b.34.5.2 b.40.4.5 PDB: 1eif_A Back     alignment and structure
>3er0_A Eukaryotic translation initiation factor 5A-2; yeast, low resolution, acetylation, hypusine, phosphoprotein, protein biosynthesis; 3.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3cpf_A Eukaryotic translation initiation factor 5A-1; structural genomics consortium, leukemia, apoptosis, SGC, acetylation, alternative splicing; 2.50A {Homo sapiens} Back     alignment and structure
>3hks_A EIF-5A-2, eukaryotic translation initiation factor 5A-2; beta barrel, alternative splicing, hypusine, protein biosynthesis; 2.30A {Arabidopsis thaliana} Back     alignment and structure
>1x6o_A Eukaryotic initiation factor 5A; SGPP, structural genomics, PSI, protein structure initiative; 1.60A {Leishmania braziliensis} SCOP: b.34.5.2 b.40.4.5 PDB: 1xtd_A Back     alignment and structure
>1khi_A HEX1; membrane sealing, peroxisomal target, structural protein; 1.78A {Neurospora crassa} SCOP: b.34.5.2 b.40.4.5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 189 elongation factor P [Candidatus Liberibacter asiaticus
d1ueba263 b.40.4.5 (A:64-126) Elongation factor P middle and C-te 2e-16
d1ueba358 b.40.4.5 (A:127-184) Elongation factor P middle and C-t 6e-15
d1ueba163 b.34.5.2 (A:1-63) Elongation factor P N-terminal domain 2e-10
d1iz6a169 b.34.5.2 (A:2-70) Eukaryotic initiation translation fac 6e-08
d1bkba171 b.34.5.2 (A:4-74) Eukaryotic initiation translation fac 3e-06
d2eifa173 b.34.5.2 (A:1-73) Eukaryotic initiation translation fac 2e-05
>d1ueba2 b.40.4.5 (A:64-126) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]} Length = 63 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Elongation factor P middle and C-terminal domains
species: Thermus thermophilus HB8 [TaxId: 300852]
 Score = 78.9 bits (195), Expect = 2e-16
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 66  FVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSV 125
           +VE +  Q+LY + E   FM+ ETY+Q  V    +   + +F+EGM     ++EG  + V
Sbjct: 1   YVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAE-FFKEGMTALGDMYEGQPIKV 59

Query: 126 EVP 128
             P
Sbjct: 60  TPP 62


>d1ueba3 b.40.4.5 (A:127-184) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]} Length = 58 Back     information, alignment and structure
>d1ueba1 b.34.5.2 (A:1-63) Elongation factor P N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]} Length = 63 Back     information, alignment and structure
>d1iz6a1 b.34.5.2 (A:2-70) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 69 Back     information, alignment and structure
>d1bkba1 b.34.5.2 (A:4-74) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d2eifa1 b.34.5.2 (A:1-73) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 73 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 elongation factor P [Candidatus Liberibacter asiaticus
d1ueba358 Elongation factor P middle and C-terminal domains {Ther 99.88
d1ueba263 Elongation factor P middle and C-terminal domains {Ther 99.81
d1bkba265 C-terminal domain of eukaryotic initiation translation 97.19
d1iz6a267 C-terminal domain of eukaryotic initiation translation 97.06
d2eifa259 C-terminal domain of eukaryotic initiation translation 96.94
d1ueba163 Elongation factor P N-terminal domain {Thermus thermoph 99.8
d1bkba171 Eukaryotic initiation translation factor 5a (eIF5a) {Ar 99.75
d1iz6a169 Eukaryotic initiation translation factor 5a (eIF5a) {Ar 99.74
d2eifa173 Eukaryotic initiation translation factor 5a (eIF5a) {Ar 99.71
d1x6oa168 Eukaryotic initiation translation factor 5a (eIF5a) {Le 98.92
d1khia176 Woronin body major protein (Hex1) {Filamentous fungi (N 97.96
>d1ueba3 b.40.4.5 (A:127-184) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Elongation factor P middle and C-terminal domains
species: Thermus thermophilus HB8 [TaxId: 300852]
Probab=99.88  E-value=1.5e-23  Score=162.35  Aligned_cols=57  Identities=35%  Similarity=0.536  Sum_probs=56.3

Q ss_pred             EEEEEEECCCCCCCCCCCCCEEEEEEECCCEEECCCCCCCCCEEEEECCCCCEEHHC
Q ss_conf             999999828542131024770008993795998474016887999988997240210
Q gi|254781067|r  131 VVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERV  187 (189)
Q Consensus       131 v~l~V~~t~p~~kG~t~~~~~K~A~letG~~i~VP~FI~~Gd~IkV~T~~g~Y~~Ra  187 (189)
                      |+|+|++|+|++||||+++++|||+||||++|+||+||++||+|+|||++|+|++||
T Consensus         2 V~l~V~etep~vKG~Ta~~~~K~a~letG~~i~VP~FI~~Gd~I~VdT~~g~Y~~RA   58 (58)
T d1ueba3           2 VELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA   58 (58)
T ss_dssp             EEEEEEECCSSSCCSSSSCSEEEEEETTSCEEEEETTCCTTCEEEEETTTTEEEEEC
T ss_pred             EEEEEEECCCCCCCCCCCCCCCEEEECCCCEEECCCCCCCCCEEEEECCCCEEECCC
T ss_conf             899999899975555456885628982899998388445999999989997674049



>d1ueba2 b.40.4.5 (A:64-126) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]} Back     information, alignment and structure
>d1bkba2 b.40.4.5 (A:75-139) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iz6a2 b.40.4.5 (A:71-137) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2eifa2 b.40.4.5 (A:74-132) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ueba1 b.34.5.2 (A:1-63) Elongation factor P N-terminal domain {Thermus thermophilus HB8 [TaxId: 300852]} Back     information, alignment and structure
>d1bkba1 b.34.5.2 (A:4-74) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iz6a1 b.34.5.2 (A:2-70) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2eifa1 b.34.5.2 (A:1-73) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1x6oa1 b.34.5.2 (A:19-86) Eukaryotic initiation translation factor 5a (eIF5a) {Leishmania infantum [TaxId: 5671]} Back     information, alignment and structure
>d1khia1 b.34.5.2 (A:27-102) Woronin body major protein (Hex1) {Filamentous fungi (Neurospora crassa) [TaxId: 5141]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 189 elongation factor P [Candidatus Liberibacter asiat
1ueb_A_64-12562 (A:64-125) EF-P, TT0860, elongation factor P; beta 8e-18
1yby_A_94-15663 (A:94-156) Translation elongation factor P; conser 1e-16
1yby_A_157-21559 (A:157-215) Translation elongation factor P; conse 6e-15
1ueb_A_126-18459 (A:126-184) EF-P, TT0860, elongation factor P; bet 8e-15
1yby_A_1-9393 (A:1-93) Translation elongation factor P; conserve 4e-14
1ueb_A_1-6363 (A:1-63) EF-P, TT0860, elongation factor P; beta b 5e-11
>1ueb_A (A:64-125) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus}Length = 62 Back     alignment and structure
 Score = 84.7 bits (210), Expect = 8e-18
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 66  FVEDQRFQFLYQDQEGFHFMNPETYDQVTVSEEVIGDQKVYFQEGMEVKLLIHEGVALSV 125
           +VE +  Q+LY + E   FM+ ETY+Q  V    +   + +F+EGM     ++EG  + V
Sbjct: 1   YVETRELQYLYPEGEEMVFMDLETYEQFAVPRSRVVGAE-FFKEGMTALGDMYEGQPIKV 59

Query: 126 EVP 128
             P
Sbjct: 60  TPP 62


>1yby_A (A:94-156) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum}Length = 63 Back     alignment and structure
>1yby_A (A:157-215) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum}Length = 59 Back     alignment and structure
>1ueb_A (A:126-184) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus}Length = 59 Back     alignment and structure
>1yby_A (A:1-93) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum}Length = 93 Back     alignment and structure
>1ueb_A (A:1-63) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus}Length = 63 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target189 elongation factor P [Candidatus Liberibacter asiaticus
1ueb_A_126-18459 EF-P, TT0860, elongation factor P; beta barrel, ri 99.89
1yby_A_157-21559 Translation elongation factor P; conserved hypothe 99.87
1yby_A_1-9393 Translation elongation factor P; conserved hypothe 99.84
1ueb_A_1-6363 EF-P, TT0860, elongation factor P; beta barrel, ri 99.8
1iz6_A_1-7070 Initiation factor 5A; SH3-like barrel, OB fold, bi 98.86
2eif_A_1-7474 IF-5A, protein (eukaryotic translation initiation 98.83
1bkb_A_1-7171 Translation initiation factor 5A; 1.75A {Pyrobacul 98.83
3cpf_A_1-7070 Eukaryotic translation initiation factor 5A-1; str 98.83
3hks_A_1-9292 EIF-5A-2, eukaryotic translation initiation factor 98.81
3er0_A_1-9494 Eukaryotic translation initiation factor 5A-2; yea 98.8
1x6o_A_1-9494 Eukaryotic initiation factor 5A; SGPP, structural 98.78
1khi_A_1-101101 HEX1; membrane sealing, peroxisomal target, struct 98.31
1yby_A_94-15663 Translation elongation factor P; conserved hypothe 99.83
1ueb_A_64-12562 EF-P, TT0860, elongation factor P; beta barrel, ri 99.79
1bkb_A_72-13665 Translation initiation factor 5A; 1.75A {Pyrobacul 97.32
1iz6_A_71-13868 Initiation factor 5A; SH3-like barrel, OB fold, bi 97.13
2eif_A_75-13662 IF-5A, protein (eukaryotic translation initiation 96.79
>1ueb_A (A:126-184) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus} Back     alignment and structure
Probab=99.89  E-value=1.7e-23  Score=164.26  Aligned_cols=59  Identities=34%  Similarity=0.505  Sum_probs=58.0

Q ss_pred             CEEEEEEEECCCCCCCCCCCCCEEEEEEECCCEEECCCCCCCCCEEEEECCCCCEEHHC
Q ss_conf             74999999828542131024770008993795998474016887999988997240210
Q gi|254781067|r  129 RHVVFTVIDTEPSSKGQTVTASYKPAILSNDIRTTVPPHINIGDDIVILTEDNSYVERV  187 (189)
Q Consensus       129 ~~v~l~V~~t~p~~kG~t~~~~~K~A~letG~~i~VP~FI~~Gd~IkV~T~~g~Y~~Ra  187 (189)
                      ++|+|+|++|+|++||||+++++|||+||||++|+||+||++||+|+|||++|+|++||
T Consensus         1 ~~V~l~V~etep~~KGdta~~~~K~A~letG~~i~VP~FI~~Gd~I~V~T~~g~Y~~RA   59 (59)
T 1ueb_A            1 TVVELKVVDTPPGVRGDTVSGGSKPATLETGAVVQVPLFVEPGEVIKVDTRTGEYVGRA   59 (59)
T ss_dssp             SEEEEEEEECCSSSCCSSSSCSEEEEEETTSCEEEEETTCCTTCEEEEETTTTEEEEEC
T ss_pred             CEEEEEEEECCCCCCCCCCCCCCCEEEEECCCEEEECCCCCCCCEEEEECCCCEEECCC
T ss_conf             67999999847610355467886629980899998488427999999989987362249



>1yby_A (A:157-215) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum} Back     alignment and structure
>1yby_A (A:1-93) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum} Back     alignment and structure
>1ueb_A (A:1-63) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus} Back     alignment and structure
>1iz6_A (A:1-70) Initiation factor 5A; SH3-like barrel, OB fold, biosynthetic protein; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2eif_A (A:1-74) IF-5A, protein (eukaryotic translation initiation factor 5A); EIF-5A, OB-fold, structural genomics; 1.80A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1bkb_A (A:1-71) Translation initiation factor 5A; 1.75A {Pyrobaculum aerophilum} Back     alignment and structure
>3cpf_A (A:1-70) Eukaryotic translation initiation factor 5A-1; structural genomics consortium, leukemia, apoptosis, SGC, acetylation, alternative splicing; 2.50A {Homo sapiens} Back     alignment and structure
>3hks_A (A:1-92) EIF-5A-2, eukaryotic translation initiation factor 5A-2; beta barrel, alternative splicing, hypusine, protein biosynthesis; 2.30A {Arabidopsis thaliana} Back     alignment and structure
>3er0_A (A:1-94) Eukaryotic translation initiation factor 5A-2; yeast, low resolution, acetylation, hypusine, phosphoprotein, protein biosynthesis; 3.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1x6o_A (A:1-94) Eukaryotic initiation factor 5A; SGPP, structural genomics, PSI, protein structure initiative; 1.60A {Leishmania braziliensis} Back     alignment and structure
>1khi_A (A:1-101) HEX1; membrane sealing, peroxisomal target, structural protein; 1.78A {Neurospora crassa} Back     alignment and structure
>1yby_A (A:94-156) Translation elongation factor P; conserved hypothetical protein, structural genomics, PSI, protein structure initiative; 1.95A {Clostridium thermocellum} Back     alignment and structure
>1ueb_A (A:64-125) EF-P, TT0860, elongation factor P; beta barrel, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.65A {Thermus thermophilus} Back     alignment and structure
>1bkb_A (A:72-136) Translation initiation factor 5A; 1.75A {Pyrobaculum aerophilum} Back     alignment and structure
>1iz6_A (A:71-138) Initiation factor 5A; SH3-like barrel, OB fold, biosynthetic protein; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2eif_A (A:75-136) IF-5A, protein (eukaryotic translation initiation factor 5A); EIF-5A, OB-fold, structural genomics; 1.80A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure