254781068

254781068

hypothetical protein CLIBASIA_04850

GeneID in NCBI database:8210091Locus tag:CLIBASIA_04850
Protein GI in NCBI database:254781068Protein Accession:YP_003065481.1
Gene range:+(1072286, 1072417)Protein Length:43aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40---
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
ccccccEEEEEEccccccEEEEEEcccccccccccccHHHHcc
cccccHHHHHHHHcccccEEEEEccccccccHccccccHHHcc
MDSSSPIALAIQNrqiggvvrfdydFKKKSYQRniknpiqler
MDSSSPIAlaiqnrqiggvvrfdydfkkksyqrniknpiqler
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
*****PI***IQNRQIGGVVRFDYDFKK***************
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
***SSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNP*****
ooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiii
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER
MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target43 hypothetical protein CLIBASIA_04850 [Candidatus Liberib
54294135 382 hypothetical protein lpl1199 [Legionella pneumophila st 1 0.002
317154368 379 glycoside hydrolase family 3 domain-containing protein 1 0.003
298529404 372 glycoside hydrolase family 3 domain protein [Desulfonat 1 0.003
52841424 395 glycosy hydrolase family protein [Legionella pneumophil 2 0.002
307609946 378 hypothetical protein LPW_12471 [Legionella pneumophila 2 0.002
21672931 372 glycosy hydrolase family protein [Chlorobium tepidum TL 2 0.003
78189925 374 glycosy hydrolase family protein [Chlorobium chlorochro 2 0.004
>gi|54294135|ref|YP_126550.1| hypothetical protein lpl1199 [Legionella pneumophila str. Lens] Length = 382 Back     alignment and organism information
 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 31/43 (72%)

Query: 1  MDSSSPIALAIQNRQIGGVVRFDYDFKKKSYQRNIKNPIQLER 43
          +D  SPIA AI+   IGGV+ FD++ + +++ +NI+NP Q+ R
Sbjct: 47 VDEKSPIAQAIEKNNIGGVILFDFNQQSQTFNKNIENPEQVNR 89


Species: Legionella pneumophila
Genus: Legionella
Family: Legionellaceae
Order: Legionellales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|317154368|ref|YP_004122416.1| glycoside hydrolase family 3 domain-containing protein [Desulfovibrio aespoeensis Aspo-2] Length = 379 Back     alignment and organism information
>gi|298529404|ref|ZP_07016807.1| glycoside hydrolase family 3 domain protein [Desulfonatronospira thiodismutans ASO3-1] Length = 372 Back     alignment and organism information
>gi|52841424|ref|YP_095223.1| glycosy hydrolase family protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 395 Back     alignment and organism information
>gi|307609946|emb|CBW99474.1| hypothetical protein LPW_12471 [Legionella pneumophila 130b] Length = 378 Back     alignment and organism information
>gi|21672931|ref|NP_660996.1| glycosy hydrolase family protein [Chlorobium tepidum TLS] Length = 372 Back     alignment and organism information
>gi|78189925|ref|YP_380263.1| glycosy hydrolase family protein [Chlorobium chlorochromatii CaD3] Length = 374 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00