254781069

254781069

hypothetical protein CLIBASIA_04855

GeneID in NCBI database:8210092Locus tag:CLIBASIA_04855
Protein GI in NCBI database:254781069Protein Accession:YP_003065482.1
Gene range:+(1072432, 1072563)Protein Length:43aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40---
MAKEADKQKVNSVESSYPLMIAIDYEGGEVSRLICTTVFAITS
cccHHHHHHHHHHHccccEEEEEEEcccEEEEEEEEEEEEEcc
ccHHHHHcccccccccccEEEEEEcccccEEEEEEEEEEEEcc
makeadkqkvnsvesSYPLMIAIDYEGGEVSRLICTTVFAITS
makeadkqkvnsvessyPLMIAIDYEGGEVSRLICTTVFAITS
MAKEADKQKVNSVESSYPLMIAIDYEGGEVSRLICTTVFAITS
***************SYPLMIAIDYEGGEVSRLICTTVFAITS
************VESSYPLMIAIDYEGGEVSRLICTTVFAITS
***********SVESSYPLMIAIDYEGGEVSRLICTTVFAITS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKEADKQKVNSVESSYPLMIAIDYEGGEVSRLICTTVFAITS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 43 hypothetical protein CLIBASIA_04855 [Candidatus Liberib
PRK05337 336 beta-hexosaminidase; Provisional 94.8
>PRK05337 beta-hexosaminidase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target43 hypothetical protein CLIBASIA_04855 [Candidatus Liberib
2oxn_A 340 Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1 92.73
>2oxn_A Beta-hexosaminidase; TIM-barrel, hydrolase; HET: OAN; 1.70A {Vibrio cholerae} PDB: 3gs6_A* 3gsm_A* 1y65_A* 1tr9_A Back     alignment and structure
Probab=92.73  E-value=0.024  Score=31.33  Aligned_cols=21  Identities=38%  Similarity=0.719  Sum_probs=18.5

Q ss_pred             CCCCEEEEEEECCCEEEEEEE
Q ss_conf             268669999607862323333
Q gi|254781069|r   15 SSYPLMIAIDYEGGEVSRLIC   35 (43)
Q Consensus        15 ssyplmiaidyeggevsrlic   35 (43)
                      +..||+|+||-|||.|+|+.-
T Consensus        53 ~~~pllIaiDqEGG~v~rl~~   73 (340)
T 2oxn_A           53 AKRPILIGVDQEGGRVQRFRE   73 (340)
T ss_dssp             HSSCCEEEECEEETTEESCCT
T ss_pred             CCCCCEEEECCCCCEEEECCC
T ss_conf             199958998158972442268




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target43 hypothetical protein CLIBASIA_04855 [Candidatus Liberib
d1tr9a_ 330 Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} 91.98
>d1tr9a_ c.1.8.7 (A:) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: NagZ-like
domain: Beta-hexosaminidase NagZ
species: Vibrio cholerae [TaxId: 666]
Probab=91.98  E-value=0.02  Score=30.62  Aligned_cols=21  Identities=38%  Similarity=0.719  Sum_probs=18.6

Q ss_pred             CCCCEEEEEEECCCEEEEEEE
Q ss_conf             268669999607862323333
Q gi|254781069|r   15 SSYPLMIAIDYEGGEVSRLIC   35 (43)
Q Consensus        15 ssyplmiaidyeggevsrlic   35 (43)
                      +..||+|+||.|||.|+|+-.
T Consensus        54 ~~~plliaiDqEgG~v~r~~~   74 (330)
T d1tr9a_          54 AKRPILIGVDQEGGRVQRFRE   74 (330)
T ss_dssp             HCSCCEEEECEEETTEESCCT
T ss_pred             CCCCEEEEECCCCCCCCCCCC
T ss_conf             499908998754234552102



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00