254781085

254781085

F0F1 ATP synthase subunit B

GeneID in NCBI database:8210109Locus tag:CLIBASIA_04935
Protein GI in NCBI database:254781085Protein Accession:YP_003065498.1
Gene range:-(1083715, 1084236)Protein Length:173aa
Gene description:F0F1 ATP synthase subunit B
COG prediction:[C] F0F1-type ATP synthase, subunit b
KEGG prediction:F0F1 ATP synthase subunit B (EC:3.6.3.14); K02109 F-type H+-transporting ATPase subunit b [EC:3.6.3.14]
SEED prediction:ATP synthase B chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccc
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQmdknttetlgsq
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMqykekhskveeETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISqkmnddvnSSIFEKTIssiqschqmdknttetlgsq
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
*HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKI***************************************************************************AKRLLYAKIADFSVEIVREIIS**M***V**SIFEKTI********************
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM***********
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDK*********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLxxxxxxxxxxxxxxxxxxxxxTREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
254781094702 glycyl-tRNA synthetase subunit beta [Candidatus Li 0.005
>gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702 Back     alignment
 Score = 32.3 bits (72), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (50%), Gaps = 16/102 (15%)

Query: 36  HADKIRDDIFEARRLREKSENILM------QYKEKHSKVEEETREIILAAKHRAKILAEE 89
           H   IR D+ EA  LR +++N+L          E  S  + E  + +L+AK   +ILA E
Sbjct: 547 HDRDIRHDLIEAI-LRPENDNLLTIVDLIKHLNEFFSSAKGE--KFLLSAKRIFQILAIE 603

Query: 90  GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131
             +N  +IS      LE    Y+ LEA++ LYA I+DF   I
Sbjct: 604 EKKN-REIS------LEISPQYLLLEAEKRLYAVISDFGTHI 638

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
315122435161 F0F1 ATP synthase subunit B [Candidatus Liberibacter so 1 2e-46
222147704161 F0F1 ATP synthase subunit B [Agrobacterium vitis S4] Le 1 6e-22
304391258161 ATP synthase B chain [Ahrensia sp. R2A130] Length = 161 1 6e-20
23501289159 F0F1 ATP synthase subunit B [Brucella suis 1330] Length 1 5e-19
62289375159 F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str 1 6e-19
153007848159 F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 1 1e-18
161511127159 F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 1 1e-18
306842324159 ATP synthase F0, B subunit [Brucella sp. BO2] Length = 1 1e-18
239831261159 ATP synthase F0, B subunit [Ochrobactrum intermedium LM 1 2e-18
148559545159 F0F1 ATP synthase subunit B [Brucella ovis ATCC 25840] 1 2e-18
>gi|315122435|ref|YP_004062924.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 161 Back     alignment and organism information
 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 131/157 (83%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVF SL+ F+++++YLR+P+ +L FLDA AD+IRD++FEARRLRE++EN+L+Q
Sbjct: 1   MHFDETFLVFTSLVAFILLLIYLRVPAKVLYFLDARADRIRDELFEARRLREEAENVLVQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEK+SK+  + REII+ A+ +AK++ ++ C+NIE++S L+L+++++ IH M+LEAKRL 
Sbjct: 61  YKEKYSKIGTDVREIIVVAEQKAKLIKDDNCKNIEKLSDLHLENVKRTIHCMELEAKRLF 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           Y K+A FS+E  +EIISQK++DD++  IF+  I  I+
Sbjct: 121 YIKLAYFSIEYAKEIISQKIDDDISCHIFQDAIREIE 157


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147704|ref|YP_002548661.1| F0F1 ATP synthase subunit B [Agrobacterium vitis S4] Length = 161 Back     alignment and organism information
>gi|304391258|ref|ZP_07373202.1| ATP synthase B chain [Ahrensia sp. R2A130] Length = 161 Back     alignment and organism information
>gi|23501289|ref|NP_697416.1| F0F1 ATP synthase subunit B [Brucella suis 1330] Length = 159 Back     alignment and organism information
>gi|62289375|ref|YP_221168.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str. 9-941] Length = 159 Back     alignment and organism information
>gi|153007848|ref|YP_001369063.1| F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 49188] Length = 159 Back     alignment and organism information
>gi|161511127|ref|NP_540460.2| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M] Length = 159 Back     alignment and organism information
>gi|306842324|ref|ZP_07474983.1| ATP synthase F0, B subunit [Brucella sp. BO2] Length = 159 Back     alignment and organism information
>gi|239831261|ref|ZP_04679590.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301] Length = 159 Back     alignment and organism information
>gi|148559545|ref|YP_001258412.1| F0F1 ATP synthase subunit B [Brucella ovis ATCC 25840] Length = 159 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
PRK09173159 PRK09173, PRK09173, F0F1 ATP synthase subunit B; Valida 2e-24
PRK13455184 PRK13455, PRK13455, F0F1 ATP synthase subunit B; Provis 2e-16
PRK14475167 PRK14475, PRK14475, F0F1 ATP synthase subunit B; Provis 1e-10
pfam00430132 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) 2e-06
PRK13460173 PRK13460, PRK13460, F0F1 ATP synthase subunit B; Provis 7e-06
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Valida 4e-04
PRK14472175 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provis 8e-04
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energ 2e-11
>gnl|CDD|169691 PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|184062 PRK13455, PRK13455, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|184697 PRK14475, PRK14475, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) Back     alignment and domain information
>gnl|CDD|139585 PRK13460, PRK13460, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|172947 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|31055 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
PRK13455184 F0F1 ATP synthase subunit B; Provisional 100.0
PRK09173159 F0F1 ATP synthase subunit B; Validated 100.0
PRK13461159 F0F1 ATP synthase subunit B; Provisional 100.0
PRK13460173 F0F1 ATP synthase subunit B; Provisional 100.0
PRK05759156 F0F1 ATP synthase subunit B; Validated 100.0
PRK06231201 F0F1 ATP synthase subunit B; Validated 100.0
PRK13453173 F0F1 ATP synthase subunit B; Provisional 100.0
PRK07352174 F0F1 ATP synthase subunit B; Validated 99.97
COG0711161 AtpF F0F1-type ATP synthase, subunit b [Energy producti 99.96
CHL00019184 atpF ATP synthase CF0 B subunit 99.96
PRK06568154 F0F1 ATP synthase subunit B; Validated 99.96
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 99.96
TIGR01144147 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005 99.95
PRK07353140 F0F1 ATP synthase subunit B'; Validated 99.95
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 99.95
PRK09174204 F0F1 ATP synthase subunit B'; Validated 99.95
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 99.95
CHL00167182 consensus 99.94
PRK08476141 F0F1 ATP synthase subunit B'; Validated 99.94
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 99.94
PRK06569157 F0F1 ATP synthase subunit B'; Validated 99.92
pfam00430132 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) ( 99.92
pfam05405163 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precur 99.18
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 98.98
PRK06231201 F0F1 ATP synthase subunit B; Validated 98.84
PRK07352174 F0F1 ATP synthase subunit B; Validated 98.4
PRK08476141 F0F1 ATP synthase subunit B'; Validated 98.37
PRK09174204 F0F1 ATP synthase subunit B'; Validated 98.34
PRK13461159 F0F1 ATP synthase subunit B; Provisional 98.23
PRK09173159 F0F1 ATP synthase subunit B; Validated 98.21
PRK06569157 F0F1 ATP synthase subunit B'; Validated 98.04
PRK05759156 F0F1 ATP synthase subunit B; Validated 97.98
PRK13455184 F0F1 ATP synthase subunit B; Provisional 97.84
CHL00019184 atpF ATP synthase CF0 B subunit 97.71
COG0711161 AtpF F0F1-type ATP synthase, subunit b [Energy producti 97.58
TIGR01144147 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005 97.54
PRK08475170 F0F1 ATP synthase subunit B; Validated 97.17
CHL00167182 consensus 96.48
PRK08475170 F0F1 ATP synthase subunit B; Validated 99.87
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 98.1
PRK07353140 F0F1 ATP synthase subunit B'; Validated 97.97
PRK00106 535 hypothetical protein; Provisional 97.11
PRK00409 780 recombination and DNA strand exchange inhibitor protein 96.45
PRK06568154 F0F1 ATP synthase subunit B; Validated 95.65
COG4046 368 Uncharacterized protein conserved in archaea [Function 91.15
PRK13453173 F0F1 ATP synthase subunit B; Provisional 98.61
PRK13460173 F0F1 ATP synthase subunit B; Provisional 98.39
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 98.01
pfam00430132 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) ( 97.18
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 97.08
TIGR0292685 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014 96.87
PRK02292187 V-type ATP synthase subunit E; Provisional 96.87
PRK01558198 V-type ATP synthase subunit E; Provisional 96.86
PRK03963198 V-type ATP synthase subunit E; Provisional 96.81
COG2811108 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy 96.34
PRK09098229 type III secretion system protein HrpB; Validated 96.02
PRK08404106 V-type ATP synthase subunit H; Validated 95.87
pfam01991195 vATP-synt_E ATP synthase (E/31 kDa) subunit. This famil 95.45
COG1390194 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy 95.42
COG2811108 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy 95.3
COG1390194 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy 94.94
pfam03179105 V-ATPase_G Vacuolar (H+)-ATPase G subunit. This family 90.08
PRK06328223 type III secretion system protein; Validated 98.16
PRK02292187 V-type ATP synthase subunit E; Provisional 97.87
PRK01558198 V-type ATP synthase subunit E; Provisional 97.76
PRK01005208 V-type ATP synthase subunit E; Provisional 97.71
PRK06937204 type III secretion system protein; Reviewed 97.55
PRK03963198 V-type ATP synthase subunit E; Provisional 97.47
PRK01005208 V-type ATP synthase subunit E; Provisional 97.33
PRK01194185 V-type ATP synthase subunit E; Provisional 96.71
TIGR02499183 HrpE_YscL_not type III secretion apparatus protein, Hrp 96.26
pfam01991195 vATP-synt_E ATP synthase (E/31 kDa) subunit. This famil 95.86
PRK06669268 fliH flagellar assembly protein H; Validated 95.7
pfam06635207 NolV Nodulation protein NolV. This family consists of s 92.54
pfam0232684 YMF19 Plant ATP synthase F0. This family corresponds to 97.61
KOG3976247 consensus 95.38
KOG2302 1956 consensus 94.2
pfam0610390 DUF948 Bacterial protein of unknown function (DUF948). 92.81
pfam04612159 GspM General secretion pathway, M protein. This is a fa 92.55
COG4741175 Predicted secreted endonuclease distantly related to ar 90.64
PRK09731178 putative general secretion pathway protein YghD; Provis 90.3
pfam12072201 DUF3552 Domain of unknown function (DUF3552). This pres 96.21
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF. 96.05
PRK00106 535 hypothetical protein; Provisional 94.21
PRK11677134 cytochrome d ubiquinol oxidase subunit III; Provisional 91.48
COG1317234 FliH Flagellar biosynthesis/type III secretory pathway 91.37
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK09173 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13461 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information
>PRK06568 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK07353 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>CHL00167 consensus Back     alignment and domain information
>PRK08476 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0) Back     alignment and domain information
>pfam05405 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precursor (ATP-synt_B) Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK08476 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK13461 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK09173 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK08475 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>CHL00167 consensus Back     alignment and domain information
>PRK08475 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>PRK07353 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK06568 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>COG4046 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0) Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275 A-ATPases (or A1A0-ATPase) (3 Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] Back     alignment and domain information
>PRK09098 type III secretion system protein HrpB; Validated Back     alignment and domain information
>PRK08404 V-type ATP synthase subunit H; Validated Back     alignment and domain information
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit Back     alignment and domain information
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] Back     alignment and domain information
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>pfam03179 V-ATPase_G Vacuolar (H+)-ATPase G subunit Back     alignment and domain information
>PRK06328 type III secretion system protein; Validated Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK06937 type III secretion system protein; Reviewed Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01194 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family; InterPro: IPR012842 This entry is related to IPR009335 from INTERPRO, but is broader Back     alignment and domain information
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit Back     alignment and domain information
>PRK06669 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>pfam06635 NolV Nodulation protein NolV Back     alignment and domain information
>pfam02326 YMF19 Plant ATP synthase F0 Back     alignment and domain information
>KOG3976 consensus Back     alignment and domain information
>KOG2302 consensus Back     alignment and domain information
>pfam06103 DUF948 Bacterial protein of unknown function (DUF948) Back     alignment and domain information
>pfam04612 GspM General secretion pathway, M protein Back     alignment and domain information
>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09731 putative general secretion pathway protein YghD; Provisional Back     alignment and domain information
>pfam12072 DUF3552 Domain of unknown function (DUF3552) Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK11677 cytochrome d ubiquinol oxidase subunit III; Provisional Back     alignment and domain information
>COG1317 FliH Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
2cly_A214 ATP synthase B chain, mitochondrial; mitochondrion, ION 4e-14
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 0.001
>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 Length = 214 Back     alignment and structure
 Score = 72.6 bits (178), Expect = 4e-14
 Identities = 18/156 (11%), Positives = 51/156 (32%), Gaps = 5/156 (3%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
                   +S I FLV +V     S+   F D   ++    + E ++   K     +  +
Sbjct: 53  ITPETFSAISTIGFLVYIVKKYGASVG-EFADKLNEQKIAQLEEVKQASIKQIQDAIDME 111

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +    + ++   +    ++   +  E   +         +K+       ++   ++    
Sbjct: 112 KSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQE 171

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            + ++  + V + IS             K I+ ++ 
Sbjct: 172 HMINWVEKRVVQSIS----AQQEKETIAKCIADLKL 203


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
2cly_A214 ATP synthase B chain, mitochondrial; mitochondrion, ION 99.84
1l2p_A61 ATP synthase B chain; alpha helix, hydrolase; 1.55A {Es 97.94
1l2p_A61 ATP synthase B chain; alpha helix, hydrolase; 1.55A {Es 94.44
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structural gen 90.43
1b9u_A34 Protein (ATP synthase); membrane protein, hydrolase; HE 97.35
3k5b_E188 V-type ATP synthase subunit E; right handed coiled coil 97.31
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structural gen 95.88
2khk_A53 ATP synthase subunit B; F1FO ATP synthase, spectroscopy 95.23
>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 PDB: 2wss_T* Back     alignment and structure
Probab=99.84  E-value=4.4e-20  Score=133.82  Aligned_cols=155  Identities=10%  Similarity=0.058  Sum_probs=142.3

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH   81 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~   81 (173)
                      -+|+.||++++|++|+++++++ +|+||.++||+|.+.|.+++++|+..+.++.+...++++++..+..++..++..+++
T Consensus        52 v~~~ef~~~lsflif~~~~~k~-~g~~i~~~Ld~r~~~I~~~l~ea~~~~~ea~~~~~e~ekkl~~~~~~~~~i~~~ake  130 (214)
T 2cly_A           52 VITPETFSAISTIGFLVYIVKK-YGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRN  130 (214)
T ss_dssp             ----------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGGHHHHHHHHH
T ss_pred             EECHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8874999999999999999999-889999999998888998999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999433999999999999999999999
Q gi|254781085|r   82 RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ  161 (173)
Q Consensus        82 ~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~~k  161 (173)
                      .+....+....++...+......+...+....+.+++.++.++++.++..+.    ..++++.++.+|+++|.+|+..-+
T Consensus       131 ~~~~~~e~~~~e~~~~v~~~~k~~ld~~~~~e~~~~~~~q~~~v~~~~~~V~----k~i~~~~~k~~i~~~I~~Lk~La~  206 (214)
T 2cly_A          131 NIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVV----QSISAQQEKETIAKCIADLKLLSK  206 (214)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT----C-----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999----876989899999999999998998



>1l2p_A ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} SCOP: f.23.21.1 Back     alignment and structure
>1l2p_A ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} SCOP: f.23.21.1 Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Pyrococcus horikoshii OT3} SCOP: d.81.4.1 PDB: 2dma_A Back     alignment and structure
>1b9u_A Protein (ATP synthase); membrane protein, hydrolase; HET: GMA; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure
>3k5b_E V-type ATP synthase subunit E; right handed coiled coil, vacuolar ATPase/synthase, V-type ATPase/synthase, A-type ATPase/synthase; 3.10A {Thermus thermophilus HB8} Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Pyrococcus horikoshii OT3} SCOP: d.81.4.1 PDB: 2dma_A Back     alignment and structure
>2khk_A ATP synthase subunit B; F1FO ATP synthase, spectroscopy, ATP synthesis, cell inner membrane, cell membrane, CF(0), hydrogen ION transport; NMR {Escherichia coli k-12} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
d1l2pa_61 F1F0 ATP synthase subunit B, membrane domain {Escherich 97.97
d1l2pa_61 F1F0 ATP synthase subunit B, membrane domain {Escherich 94.66
>d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Single transmembrane helix
superfamily: F1F0 ATP synthase subunit B, membrane domain
family: F1F0 ATP synthase subunit B, membrane domain
domain: F1F0 ATP synthase subunit B, membrane domain
species: Escherichia coli [TaxId: 562]
Probab=97.97  E-value=3.4e-05  Score=46.08  Aligned_cols=60  Identities=20%  Similarity=0.213  Sum_probs=57.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   63 EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA  122 (173)
Q Consensus        63 ~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~  122 (173)
                      ..|.+++.++..|+.+|+..+..+++++...+..+.++++..++.+|+.+...++.+||.
T Consensus         2 e~L~eAK~eAa~Ii~qA~~ra~qIveeak~~A~~Ea~rI~~~A~~eIe~E~~~A~~eLRk   61 (61)
T d1l2pa_           2 DQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRK   61 (61)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             777999999999999999889999999999999999999998999999999999997509



>d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 173 F0F1 ATP synthase subunit B [Candidatus Liberibact
2cly_A_214 (A:) ATP synthase B chain, mitochondrial; mitochon 1e-14
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus}Length = 214 Back     alignment and structure
 Score = 73.8 bits (181), Expect = 1e-14
 Identities = 17/156 (10%), Positives = 52/156 (33%), Gaps = 5/156 (3%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
                   +S I FLV +V     + +  F D   ++    + E ++   K     +  +
Sbjct: 53  ITPETFSAISTIGFLVYIVKK-YGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDME 111

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +    + ++   +    ++   +  E   +         +K+         +  + ++  
Sbjct: 112 KSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYH----ISVQNMMRQ 167

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K  +  +  V + + Q ++         K I+ ++ 
Sbjct: 168 KEQEHMINWVEKRVVQSISAQQEKETIAKCIADLKL 203


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target173 F0F1 ATP synthase subunit B [Candidatus Liberibacter as
2cly_A_214 ATP synthase B chain, mitochondrial; mitochondrion 99.85
1l2p_A_61 ATP synthase B chain; alpha helix, hydrolase; 1.55 97.9
1b9u_A_34 Protein (ATP synthase); membrane protein; HET: GMA 96.97
2khk_A_53 ATP synthase subunit B; F1FO ATP synthase, spectro 94.03
2cly_A_214 ATP synthase B chain, mitochondrial; mitochondrion 94.02
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} Back     alignment and structure
Probab=99.85  E-value=3.4e-20  Score=135.36  Aligned_cols=155  Identities=10%  Similarity=0.066  Sum_probs=140.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899999999999999999962288999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR   82 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~   82 (173)
                      +|..||++++|++|+++++++ +|+||.++||+|.+.|.+++++|+..+.++.+.+.+|++++..+..++..|+..++++
T Consensus        53 ~n~e~~~~i~F~i~~~l~~k~-~~~~i~~~ld~R~~~I~~~l~~a~~~~~ea~~~~~e~~~~l~~~~~~~~~I~~~ake~  131 (214)
T 2cly_A           53 ITPETFSAISTIGFLVYIVKK-YGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNN  131 (214)
T ss_dssp             ---------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGGHHHHHHHHHH
T ss_pred             ECHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             880799999999999999999-8999999999989999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999994339999999999999999999999
Q gi|254781085|r   83 AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM  162 (173)
Q Consensus        83 a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~~k~  162 (173)
                      +....+....+....+......+...+......+++.+++++++.+    .+.+...++++.++++|+++|.+|+.....
T Consensus       132 a~~~~E~~~~e~~~~~~~~~k~~ld~~~~~e~~~r~~~q~~~v~~v----~~~v~k~i~~~~~~~li~~~I~~L~~la~k  207 (214)
T 2cly_A          132 IAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWV----EKRVVQSISAQQEKETIAKCIADLKLLSKK  207 (214)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHTC------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999----999998758888999999999999989987



>1l2p_A (A:) ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} Back     alignment and structure
>1b9u_A (A:) Protein (ATP synthase); membrane protein; HET: GMA; NMR {Synthetic} Back     alignment and structure
>2khk_A (A:) ATP synthase subunit B; F1FO ATP synthase, spectroscopy, ATP synthesis, cell inner membrane, cell membrane, CF(0), hydrogen ION transport; NMR {Escherichia coli k-12} Back     alignment and structure
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} Back     alignment and structure