254781086

254781086

F0F1 ATP synthase subunit B'

GeneID in NCBI database:8210110Locus tag:CLIBASIA_04940
Protein GI in NCBI database:254781086Protein Accession:YP_003065499.1
Gene range:-(1084226, 1084756)Protein Length:176aa
Gene description:F0F1 ATP synthase subunit B'
COG prediction:[C] F0F1-type ATP synthase, subunit b
KEGG prediction:F0F1 ATP synthase subunit B' (EC:3.6.3.14); K02109 F-type H+-transporting ATPase subunit b [EC:3.6.3.14]
SEED prediction:ATP synthase B chain (EC 3.6.3.14)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:F0F1-type ATP synthase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
cccccccccccccccccHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccHccc
masssssdfssrfppfdtstflSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKlgfsvsdaDVQKILDRkrdgidaf
masssssdfssrfpPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLissdqekmdSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRklgfsvsdadvqkildrkrdgidaf
MAsssssdfssrfppfdtstfLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
***************FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLIS*************************************************************************KASQEVYSIVGEVTKDLVRKLG**********ILDRKRDGIDA*
************FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS***************ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
***********RFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG****
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFxxxxxxxxxxxxxxxxxxxxxASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
315122434175 F0F1 ATP synthase subunit B' [Candidatus Liberibacter s 1 2e-51
150395674204 F0F1 ATP synthase subunit B' [Sinorhizobium medicae WSM 1 9e-24
118590787175 F0F1 ATP synthase subunit B' [Stappia aggregata IAM 126 1 3e-23
304391257174 ATP synthase B' chain [Ahrensia sp. R2A130] Length = 17 1 3e-23
254471829184 ATP synthase protein, subunit B` [Pseudovibrio sp. JE06 1 4e-23
328544976169 F0F1 ATP synthase subunit B' [polymorphum gilvum SL003B 1 6e-23
307941610185 ATP synthase B' chain [Roseibium sp. TrichSKD4] Length 1 8e-23
254500907181 ATP synthase B/B' CF(0) superfamily [Labrenzia alexandr 1 1e-22
226698383188 RecName: Full=ATP synthase subunit b/b'; AltName: Full= 1 2e-22
121602545161 F0F1 ATP synthase subunit B' [Bartonella bacilliformis 1 2e-22
>gi|315122434|ref|YP_004062923.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 175 Back     alignment and organism information
 Score =  205 bits (522), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 97/160 (60%), Positives = 129/160 (80%), Gaps = 1/160 (0%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           ++SSDFSS+FPPFDTSTFLSQFFWL +IFGIFYW+ HRF+LPRL+  M +R N ISSDQ 
Sbjct: 2   ATSSDFSSKFPPFDTSTFLSQFFWLVVIFGIFYWIMHRFVLPRLAFGMILRHNQISSDQS 61

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           KM++A  E+ SM +SYEE+LAIAR +AKEI+ K +  AEQNLE +R++FEKDLLH++S A
Sbjct: 62  KMEAAVMELNSMTASYEEALAIARTNAKEIVQKAIIDAEQNLECKRKMFEKDLLHEISVA 121

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADV 162
           Q +I+  Q+K+ +E+ S+   +TKDL+ KL G S+SD D+
Sbjct: 122 QRKIESTQEKSLKELQSVSEGITKDLIHKLMGISISDVDI 161


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395674|ref|YP_001326141.1| F0F1 ATP synthase subunit B' [Sinorhizobium medicae WSM419] Length = 204 Back     alignment and organism information
>gi|118590787|ref|ZP_01548188.1| F0F1 ATP synthase subunit B' [Stappia aggregata IAM 12614] Length = 175 Back     alignment and organism information
>gi|304391257|ref|ZP_07373201.1| ATP synthase B' chain [Ahrensia sp. R2A130] Length = 174 Back     alignment and organism information
>gi|254471829|ref|ZP_05085230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062] Length = 184 Back     alignment and organism information
>gi|328544976|ref|YP_004305085.1| F0F1 ATP synthase subunit B' [polymorphum gilvum SL003B-26A1] Length = 169 Back     alignment and organism information
>gi|307941610|ref|ZP_07656965.1| ATP synthase B' chain [Roseibium sp. TrichSKD4] Length = 185 Back     alignment and organism information
>gi|254500907|ref|ZP_05113058.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11] Length = 181 Back     alignment and organism information
>gi|226698383|sp|A1URU4|ATPX_BARBK RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase F(0) sector subunit b/b'; AltName: Full=ATPase subunit II; AltName: Full=F-type ATPase subunit b/b'; Short=F-ATPase subunit b/b' Length = 188 Back     alignment and organism information
>gi|121602545|ref|YP_988697.1| F0F1 ATP synthase subunit B' [Bartonella bacilliformis KC583] Length = 161 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
PRK09174204 PRK09174, PRK09174, F0F1 ATP synthase subunit B'; Valid 2e-28
PRK13454181 PRK13454, PRK13454, F0F1 ATP synthase subunit B'; Provi 4e-14
PRK05759156 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Valida 2e-12
PRK06569155 PRK06569, PRK06569, F0F1 ATP synthase subunit B'; Valid 5e-09
pfam00430132 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) 1e-08
PRK14472175 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provis 2e-04
TIGR01144147 TIGR01144, ATP_synt_b, ATP synthase, F0 subunit b 0.001
COG0711161 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energ 3e-13
pfam0232684 pfam02326, YMF19, Plant ATP synthase F0 1e-07
MTH0016967 MTH00169, ATP8, ATP synthase F0 subunit 8; Provisional 3e-04
>gnl|CDD|169692 PRK09174, PRK09174, F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|184061 PRK13454, PRK13454, F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>gnl|CDD|180240 PRK05759, PRK05759, F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>gnl|CDD|180627 PRK06569, PRK06569, F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0) Back     alignment and domain information
>gnl|CDD|172947 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|130214 TIGR01144, ATP_synt_b, ATP synthase, F0 subunit b Back     alignment and domain information
>gnl|CDD|31055 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|111240 pfam02326, YMF19, Plant ATP synthase F0 Back     alignment and domain information
>gnl|CDD|177224 MTH00169, ATP8, ATP synthase F0 subunit 8; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 100.0
PRK09174204 F0F1 ATP synthase subunit B'; Validated 100.0
PRK06569157 F0F1 ATP synthase subunit B'; Validated 100.0
PRK13455184 F0F1 ATP synthase subunit B; Provisional 100.0
PRK13460173 F0F1 ATP synthase subunit B; Provisional 100.0
PRK06231201 F0F1 ATP synthase subunit B; Validated 100.0
PRK07352174 F0F1 ATP synthase subunit B; Validated 99.98
PRK13453173 F0F1 ATP synthase subunit B; Provisional 99.97
PRK13461159 F0F1 ATP synthase subunit B; Provisional 99.97
PRK05759156 F0F1 ATP synthase subunit B; Validated 99.96
PRK09173159 F0F1 ATP synthase subunit B; Validated 99.96
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 99.96
CHL00019184 atpF ATP synthase CF0 B subunit 99.95
COG0711161 AtpF F0F1-type ATP synthase, subunit b [Energy producti 99.95
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 99.94
PRK08476141 F0F1 ATP synthase subunit B'; Validated 99.94
PRK07353140 F0F1 ATP synthase subunit B'; Validated 99.94
CHL00167182 consensus 99.92
pfam00430132 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) ( 99.91
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 99.91
PRK06568154 F0F1 ATP synthase subunit B; Validated 99.89
PRK08475170 F0F1 ATP synthase subunit B; Validated 99.85
PRK06231201 F0F1 ATP synthase subunit B; Validated 99.13
PRK09173159 F0F1 ATP synthase subunit B; Validated 99.04
pfam05405163 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precur 98.95
PRK13453173 F0F1 ATP synthase subunit B; Provisional 98.95
PRK13460173 F0F1 ATP synthase subunit B; Provisional 98.92
PRK07352174 F0F1 ATP synthase subunit B; Validated 98.8
PRK13461159 F0F1 ATP synthase subunit B; Provisional 98.76
pfam00430132 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) ( 98.61
PRK13454181 F0F1 ATP synthase subunit B'; Provisional 98.57
PRK05759156 F0F1 ATP synthase subunit B; Validated 98.53
CHL00118156 atpG ATP synthase CF0 B' subunit; Validated 98.51
PRK09174204 F0F1 ATP synthase subunit B'; Validated 98.41
TIGR01144147 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005 98.32
COG0711161 AtpF F0F1-type ATP synthase, subunit b [Energy producti 98.16
PRK07353140 F0F1 ATP synthase subunit B'; Validated 98.07
PRK06569157 F0F1 ATP synthase subunit B'; Validated 97.73
PRK13428 445 F0F1 ATP synthase subunit delta; Provisional 97.23
TIGR01144147 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005 99.94
PRK13455184 F0F1 ATP synthase subunit B; Provisional 98.49
CHL00019184 atpF ATP synthase CF0 B subunit 98.34
CHL00167182 consensus 97.77
pfam0232684 YMF19 Plant ATP synthase F0. This family corresponds to 99.33
MTH0016971 ATP8 ATP synthase F0 subunit 8; Provisional 98.27
MTH0002570 ATP8 ATP synthase F0 subunit 8; Validated 97.96
PRK12705 485 hypothetical protein; Provisional 96.53
KOG3976247 consensus 96.52
PRK08475170 F0F1 ATP synthase subunit B; Validated 98.34
PRK06568154 F0F1 ATP synthase subunit B; Validated 98.24
TIGR03321246 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC a 97.29
PRK00106 535 hypothetical protein; Provisional 96.67
PRK00409 780 recombination and DNA strand exchange inhibitor protein 96.36
PRK00083185 frr ribosome recycling factor; Reviewed 93.82
cd00520179 RRF Ribosome recycling factor (RRF). Ribosome recycling 93.2
COG0233187 Frr Ribosome recycling factor [Translation, ribosomal s 91.1
PRK08476141 F0F1 ATP synthase subunit B'; Validated 98.3
PRK01005208 V-type ATP synthase subunit E; Provisional 97.68
PRK02292187 V-type ATP synthase subunit E; Provisional 97.59
PRK01558198 V-type ATP synthase subunit E; Provisional 97.43
PRK01558198 V-type ATP synthase subunit E; Provisional 96.68
PRK02292187 V-type ATP synthase subunit E; Provisional 96.67
PRK06328223 type III secretion system protein; Validated 96.53
PRK03963198 V-type ATP synthase subunit E; Provisional 96.45
TIGR0292685 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014 96.39
COG2811108 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy 96.27
pfam03179105 V-ATPase_G Vacuolar (H+)-ATPase G subunit. This family 96.2
COG2811108 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy 95.98
TIGR0292685 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014 95.7
TIGR01147114 V_ATP_synt_G V-type ATPase, G subunit; InterPro: IPR005 95.3
PRK08404106 V-type ATP synthase subunit H; Validated 95.1
PRK06937204 type III secretion system protein; Reviewed 95.05
COG1390194 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy 94.97
KOG1772108 consensus 94.66
PRK08404106 V-type ATP synthase subunit H; Validated 94.17
PRK01194185 V-type ATP synthase subunit E; Provisional 94.11
COG1390194 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy 92.98
PRK09098229 type III secretion system protein HrpB; Validated 92.08
PRK06669268 fliH flagellar assembly protein H; Validated 91.98
TIGR02499183 HrpE_YscL_not type III secretion apparatus protein, Hrp 91.17
PRK01005208 V-type ATP synthase subunit E; Provisional 97.55
PRK03963198 V-type ATP synthase subunit E; Provisional 96.7
PRK00409 780 recombination and DNA strand exchange inhibitor protein 96.54
pfam01991195 vATP-synt_E ATP synthase (E/31 kDa) subunit. This famil 95.72
pfam0593347 Fun_ATP-synt_8 Fungal ATP synthase protein 8 (A6L). Thi 97.32
pfam0089555 ATP-synt_8 ATP synthase protein 8. 94.23
MTH0010267 ATP8 ATP synthase F0 subunit 8; Validated 92.76
KOG0718546 consensus 92.55
pfam06936190 Selenoprotein_S Selenoprotein S (SelS). This family con 91.05
COG186297 YajC Preprotein translocase subunit YajC [Intracellular 90.94
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13461 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK09173 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>PRK08476 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK07353 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>CHL00167 consensus Back     alignment and domain information
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0) Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK06568 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK08475 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK06231 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK09173 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>pfam05405 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precursor (ATP-synt_B) Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK13460 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07352 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK13461 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0) Back     alignment and domain information
>PRK13454 F0F1 ATP synthase subunit B'; Provisional Back     alignment and domain information
>PRK05759 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated Back     alignment and domain information
>PRK09174 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion] Back     alignment and domain information
>PRK07353 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK13428 F0F1 ATP synthase subunit delta; Provisional Back     alignment and domain information
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PRK13455 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>CHL00019 atpF ATP synthase CF0 B subunit Back     alignment and domain information
>CHL00167 consensus Back     alignment and domain information
>pfam02326 YMF19 Plant ATP synthase F0 Back     alignment and domain information
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional Back     alignment and domain information
>MTH00025 ATP8 ATP synthase F0 subunit 8; Validated Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG3976 consensus Back     alignment and domain information
>PRK08475 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>PRK06568 F0F1 ATP synthase subunit B; Validated Back     alignment and domain information
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK00083 frr ribosome recycling factor; Reviewed Back     alignment and domain information
>cd00520 RRF Ribosome recycling factor (RRF) Back     alignment and domain information
>COG0233 Frr Ribosome recycling factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08476 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK01558 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK02292 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK06328 type III secretion system protein; Validated Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275 A-ATPases (or A1A0-ATPase) (3 Back     alignment and domain information
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] Back     alignment and domain information
>pfam03179 V-ATPase_G Vacuolar (H+)-ATPase G subunit Back     alignment and domain information
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion] Back     alignment and domain information
>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275 A-ATPases (or A1A0-ATPase) (3 Back     alignment and domain information
>TIGR01147 V_ATP_synt_G V-type ATPase, G subunit; InterPro: IPR005124 This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit Back     alignment and domain information
>PRK08404 V-type ATP synthase subunit H; Validated Back     alignment and domain information
>PRK06937 type III secretion system protein; Reviewed Back     alignment and domain information
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>KOG1772 consensus Back     alignment and domain information
>PRK08404 V-type ATP synthase subunit H; Validated Back     alignment and domain information
>PRK01194 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion] Back     alignment and domain information
>PRK09098 type III secretion system protein HrpB; Validated Back     alignment and domain information
>PRK06669 fliH flagellar assembly protein H; Validated Back     alignment and domain information
>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family; InterPro: IPR012842 This entry is related to IPR009335 from INTERPRO, but is broader Back     alignment and domain information
>PRK01005 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK03963 V-type ATP synthase subunit E; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit Back     alignment and domain information
>pfam05933 Fun_ATP-synt_8 Fungal ATP synthase protein 8 (A6L) Back     alignment and domain information
>pfam00895 ATP-synt_8 ATP synthase protein 8 Back     alignment and domain information
>MTH00102 ATP8 ATP synthase F0 subunit 8; Validated Back     alignment and domain information
>KOG0718 consensus Back     alignment and domain information
>pfam06936 Selenoprotein_S Selenoprotein S (SelS) Back     alignment and domain information
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
2cly_A214 ATP synthase B chain, mitochondrial; mitochondrion, ION 6e-15
>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 Length = 214 Back     alignment and structure
 Score = 75.7 bits (186), Expect = 6e-15
 Identities = 16/147 (10%), Positives = 42/147 (28%), Gaps = 3/147 (2%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           ++   + AI    F     +     +    +       +  E++  A  +        E+
Sbjct: 53  ITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEK 112

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           S          + D         LE         +  ++ N  +    +Q    Q+    
Sbjct: 113 SQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEH 172

Query: 142 VGEVTKDLVRKLGFSVSDADVQKILDR 168
           +    +  V +   S+S    ++ + +
Sbjct: 173 MINWVEKRVVQ---SISAQQEKETIAK 196


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
2cly_A214 ATP synthase B chain, mitochondrial; mitochondrion, ION 99.78
1l2p_A61 ATP synthase B chain; alpha helix, hydrolase; 1.55A {Es 97.84
1l2p_A61 ATP synthase B chain; alpha helix, hydrolase; 1.55A {Es 96.1
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structural gen 94.68
3k5b_E188 V-type ATP synthase subunit E; right handed coiled coil 94.54
2dm9_A198 V-type ATP synthase subunit E; A-ATPase, structural gen 91.35
2cly_A214 ATP synthase B chain, mitochondrial; mitochondrion, ION 97.75
1b9u_A34 Protein (ATP synthase); membrane protein, hydrolase; HE 97.21
3k5b_E188 V-type ATP synthase subunit E; right handed coiled coil 96.93
2khk_A53 ATP synthase subunit B; F1FO ATP synthase, spectroscopy 95.71
>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 PDB: 2wss_T* Back     alignment and structure
Probab=99.78  E-value=7.7e-18  Score=128.74  Aligned_cols=155  Identities=10%  Similarity=-0.005  Sum_probs=136.7

Q ss_pred             HHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88768-89999999999999999999554089999999999999999999999999999999999999999999999999
Q gi|254781086|r   18 TSTFL-SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDK   96 (176)
Q Consensus        18 ~~~f~-~q~fw~~I~F~il~~il~~~~~~pi~~~l~~R~~~I~~~l~~A~~~~~eae~~~~~~e~~l~eak~ea~~ii~~   96 (176)
                      .+.|. +.=||++++|++|+++++|++||||.+++|+|.+.|.+++++|+..+.++.+...++++++.+++.++..+++.
T Consensus        48 kei~v~~~ef~~~lsflif~~~~~k~~g~~i~~~Ld~r~~~I~~~l~ea~~~~~ea~~~~~e~ekkl~~~~~~~~~i~~~  127 (214)
T 2cly_A           48 KEIYVITPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDV  127 (214)
T ss_dssp             -------------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGGHHHHHH
T ss_pred             CCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             86048874999999999999999999889999999998888998999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999999999999999999999999999999999999999999998415999999999999942106
Q gi|254781086|r   97 VVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA  175 (176)
Q Consensus        97 a~~~a~~~~e~~~~~a~~ei~~~~~~a~~~I~~~k~~a~~ei~~~a~~~a~~i~~kl~~~~~~~~~~~~i~~~~~~i~~  175 (176)
                      +++.+....+....++..++.....++...+....+.++..+++.+++.+...+.+   .+++...++++++.++++..
T Consensus       128 ake~~~~~~e~~~~e~~~~v~~~~k~~ld~~~~~e~~~~~~~q~~~v~~~~~~V~k---~i~~~~~k~~i~~~I~~Lk~  203 (214)
T 2cly_A          128 QRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ---SISAQQEKETIAKCIADLKL  203 (214)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC-----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999998---76989899999999999998



>1l2p_A ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} SCOP: f.23.21.1 Back     alignment and structure
>1l2p_A ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} SCOP: f.23.21.1 Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Pyrococcus horikoshii OT3} SCOP: d.81.4.1 PDB: 2dma_A Back     alignment and structure
>3k5b_E V-type ATP synthase subunit E; right handed coiled coil, vacuolar ATPase/synthase, V-type ATPase/synthase, A-type ATPase/synthase; 3.10A {Thermus thermophilus HB8} Back     alignment and structure
>2dm9_A V-type ATP synthase subunit E; A-ATPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.85A {Pyrococcus horikoshii OT3} SCOP: d.81.4.1 PDB: 2dma_A Back     alignment and structure
>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} SCOP: f.52.1.1 PDB: 2wss_T* Back     alignment and structure
>1b9u_A Protein (ATP synthase); membrane protein, hydrolase; HET: GMA; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure
>3k5b_E V-type ATP synthase subunit E; right handed coiled coil, vacuolar ATPase/synthase, V-type ATPase/synthase, A-type ATPase/synthase; 3.10A {Thermus thermophilus HB8} Back     alignment and structure
>2khk_A ATP synthase subunit B; F1FO ATP synthase, spectroscopy, ATP synthesis, cell inner membrane, cell membrane, CF(0), hydrogen ION transport; NMR {Escherichia coli k-12} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
d1l2pa_61 F1F0 ATP synthase subunit B, membrane domain {Escherich 97.89
d1l2pa_61 F1F0 ATP synthase subunit B, membrane domain {Escherich 96.19
>d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Single transmembrane helix
superfamily: F1F0 ATP synthase subunit B, membrane domain
family: F1F0 ATP synthase subunit B, membrane domain
domain: F1F0 ATP synthase subunit B, membrane domain
species: Escherichia coli [TaxId: 562]
Probab=97.89  E-value=6.1e-05  Score=47.62  Aligned_cols=59  Identities=27%  Similarity=0.330  Sum_probs=56.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999
Q gi|254781086|r   81 ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY  139 (176)
Q Consensus        81 ~~l~eak~ea~~ii~~a~~~a~~~~e~~~~~a~~ei~~~~~~a~~~I~~~k~~a~~ei~  139 (176)
                      ..|.+|+.++..|+++|+..+..++++.+.++..+.++++..++.+|+.++..+..+|+
T Consensus         2 e~L~eAK~eAa~Ii~qA~~ra~qIveeak~~A~~Ea~rI~~~A~~eIe~E~~~A~~eLR   60 (61)
T d1l2pa_           2 DQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELR   60 (61)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             77799999999999999988999999999999999999999899999999999999750



>d1l2pa_ f.23.21.1 (A:) F1F0 ATP synthase subunit B, membrane domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 176 F0F1 ATP synthase subunit B' [Candidatus Liberibac
2cly_A_214 (A:) ATP synthase B chain, mitochondrial; mitochon 8e-13
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus}Length = 214 Back     alignment and structure
 Score = 67.6 bits (165), Expect = 8e-13
 Identities = 18/147 (12%), Positives = 44/147 (29%), Gaps = 11/147 (7%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
            + AI    F     +     +    +       +  E++  A  +        E+S   
Sbjct: 57  TFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQA 116

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN----AQNEIDDMQKKASQEVYSI 141
                  + D        N+    EV  ++ LH++        +    +Q    Q+    
Sbjct: 117 LVQKRHYLFD----VQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEH 172

Query: 142 VGEVTKDLVRKLGFSVSDADVQKILDR 168
           +    +  V +   S+S    ++ + +
Sbjct: 173 MINWVEKRVVQ---SISAQQEKETIAK 196


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target176 F0F1 ATP synthase subunit B' [Candidatus Liberibacter a
2cly_A_214 ATP synthase B chain, mitochondrial; mitochondrion 99.82
1l2p_A_61 ATP synthase B chain; alpha helix, hydrolase; 1.55 97.82
1l2p_A_61 ATP synthase B chain; alpha helix, hydrolase; 1.55 95.33
1b9u_A_34 Protein (ATP synthase); membrane protein; HET: GMA 96.93
2cly_A_214 ATP synthase B chain, mitochondrial; mitochondrion 96.63
2khk_A_53 ATP synthase subunit B; F1FO ATP synthase, spectro 94.84
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} Back     alignment and structure
Probab=99.82  E-value=6.1e-19  Score=136.52  Aligned_cols=150  Identities=11%  Similarity=-0.019  Sum_probs=138.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999999554089999999999999999999999999999999999999999999999999999999
Q gi|254781086|r   23 SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAE  102 (176)
Q Consensus        23 ~q~fw~~I~F~il~~il~~~~~~pi~~~l~~R~~~I~~~l~~A~~~~~eae~~~~~~e~~l~eak~ea~~ii~~a~~~a~  102 (176)
                      +--||.+|+|++|++++++|+||||.+++|+|.+.|.+++++|+..+.++.+...+|++.+.+++.++..|++.++..+.
T Consensus        54 n~e~~~~i~F~i~~~l~~k~~~~~i~~~ld~R~~~I~~~l~~a~~~~~ea~~~~~e~~~~l~~~~~~~~~I~~~ake~a~  133 (214)
T 2cly_A           54 TPETFSAISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIA  133 (214)
T ss_dssp             -------------------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTGGGHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             80799999999999999999899999999998999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999999999999999999999999999999999999998415999999999999942106
Q gi|254781086|r  103 QNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA  175 (176)
Q Consensus       103 ~~~e~~~~~a~~ei~~~~~~a~~~I~~~k~~a~~ei~~~a~~~a~~i~~kl~~~~~~~~~~~~i~~~~~~i~~  175 (176)
                      ...+....+...++.+.+.++...+...+..+...+++.+++.+...+.+   .++....++++++++.+++.
T Consensus       134 ~~~E~~~~e~~~~~~~~~k~~ld~~~~~e~~~r~~~q~~~v~~v~~~v~k---~i~~~~~~~li~~~I~~L~~  203 (214)
T 2cly_A          134 MALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKRVVQ---SISAQQEKETIAKCIADLKL  203 (214)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTC-----------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999998---75888899999999999998



>1l2p_A (A:) ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} Back     alignment and structure
>1l2p_A (A:) ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli} Back     alignment and structure
>1b9u_A (A:) Protein (ATP synthase); membrane protein; HET: GMA; NMR {Synthetic} Back     alignment and structure
>2cly_A (A:) ATP synthase B chain, mitochondrial; mitochondrion, ION transport, CF(0), stator, transport, acetylation, hydrogen ION transport; 2.8A {Bos taurus} Back     alignment and structure
>2khk_A (A:) ATP synthase subunit B; F1FO ATP synthase, spectroscopy, ATP synthesis, cell inner membrane, cell membrane, CF(0), hydrogen ION transport; NMR {Escherichia coli k-12} Back     alignment and structure