254781096

254781096

UDP-N-acetylmuramate--L-alanine ligase

GeneID in NCBI database:8210121Locus tag:CLIBASIA_04990
Protein GI in NCBI database:254781096Protein Accession:YP_003065509.1
Gene range:-(1093873, 1095297)Protein Length:474aa
Gene description:UDP-N-acetylmuramate--L-alanine ligase
COG prediction:none
KEGG prediction:murC; UDP-N-acetylmuramate--L-alanine ligase (EC:6.3.2.8); K01924 UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
SEED prediction:UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)
Pathway involved in KEGG:D-Glutamine and D-glutamate metabolism [PATH:las00471]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM
cccHHHcccEEEEEEEHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHcccEEEEcccHHHcccccEEEEccccccccHHHHHHHHccccEEEEHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccEEEEEcccccccEEEEEccEEEEccccHHHHHHcccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEEccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHcccccEEEEccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcccccccc
ccccHHcccEEEEccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccEEEEcccHHHHccccEEEEccccccccHHHHHHHHccccEEEHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEcccccEEEEEcccHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHccccccccEEEEcccccccEEEEEEEEccccEEEEEEEEccccccccccccEEccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccEEEEEcccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEccEcHHHHHHcHHHHHHHHccccEEEEEccEcccccccccccHHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHcHHccccc
mlnpqgmgpihfvGIGGIGMSGIAEVLhntghqvqgsdvilgpnvqrlHKQGIKVSighkvenidnAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRksisvsgthgktTTTSLIAALLEqgkfdptvinggiinsygtnarigtseWIVVEadesdgtfirlpsdivvvtnidpehldyygdFNAIRAAFYKFidnipfygfavvcmdhPEVRSLIARIQNRkiitygrhpqadirysnirkysgrsifdvsvqgnvtkdLTVIkdlslpligehniSNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNdvhvfddyghhpiEISSVLAAVRQICPRkiiaihqphrysrlstlfdqfsscfgdadivlispvysagekeipgfsspelvkniklqghpqayymDSFDHLVSKILAiaepgdfiiffgaGNITQWAASLIGelelvtpqnvcmm
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTaidkdnveciaarernipiifrSEMLAGLMRCRKSisvsgthgkTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIqnrkiitygrhpqadirysnirkYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGelelvtpqnvcmm
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM
*****GM*PIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTP***C*M
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM
*LNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVT****C**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM
MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKIIAIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQNVCMM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus Libe
254781099468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 4e-07
254781101472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diamino 2e-05
>gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Back     alignment
 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 85/335 (25%), Positives = 141/335 (42%), Gaps = 42/335 (12%)

Query: 11  HFVGIGGIGMSGI--AEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHKVENIDNAE 68
           H + + G+G SG+  A  L ++G  V   D          H   +K +    +E ID  E
Sbjct: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDD---------HPCAVKQAKDMGIEVIDFRE 59

Query: 69  I-------LVLS--TAIDKDNVE-CIA-ARERNIPIIFRSEMLAGLMRCRK----SISVS 113
           I       LVLS   A+  +N   C+  A + N+ II   E+     R        I+V+
Sbjct: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119

Query: 114 GTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNAR-IGTSEWIVVEADESDGTFI- 171
           GT+GK++T +LI+ +L +  +D  +  GG I     N      + + V+E          
Sbjct: 120 GTNGKSSTVALISHVLRKNGYDVQL--GGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177

Query: 172 RLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQ 231
            +   I V+ NI P+HLD +           K +        A++C++  +    IA   
Sbjct: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEK-IAYDM 233

Query: 232 NRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNA 291
           N     +  H  + I   +++  S   I +  ++ + T +  VI D S     +HNI N 
Sbjct: 234 N-----FIGHSISRISSQSLQSDSDLYIDESFLKCSATSE--VIFDFSQE-TKKHNIQNL 285

Query: 292 CASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVG 326
             S  V  +LGL  E++K+ L S  G+  R   + 
Sbjct: 286 VTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIA 320

>gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Back     alignment
 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 114/275 (41%), Gaps = 25/275 (9%)

Query: 100 LAGLMRCRKSI-SVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYG---TNARIGT 155
           +A  +R + +I +++G+ GKTTT  ++   L   K     I G   N  G   T AR+  
Sbjct: 100 VAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACI-GSYNNHIGVPLTLARMPV 158

Query: 156 S-EWIVVEADESDGTFIRLPSDIV-----VVTNIDPEHLDYYGDFNAIRAAFYKFIDNIP 209
             ++ + E   S    IR  + +V     V+T I P HL  +     I +A  +  + + 
Sbjct: 159 DVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLE 218

Query: 210 FYGFAVVCMDHPEVRSLIAR---IQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQG 266
             G   +  D      L A+   +  + I ++G+   AD +    ++ S +S  +V +QG
Sbjct: 219 KTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQG 278

Query: 267 NVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASF---SGIKRRFT 323
              K + V+       IG H   N   ++ +   L    +   K L+ F    G  +R+ 
Sbjct: 279 ---KSMEVVHH----GIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYR 331

Query: 324 LVGVWNDVHVFDD-YGHHPIEISSVLAAVRQICPR 357
                    + D+ Y  +P  + + ++ + QI P 
Sbjct: 332 CALNQGFFTLIDESYNANPASMKAAISVLSQISPH 366

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus Libe
315122420475 UDP-N-acetylmuramate--L-alanine ligase [Candidatus Libe 1 0.0
15889377471 UDP-N-acetylmuramate--L-alanine ligase [Agrobacterium t 1 1e-165
222149135471 UDP-N-acetylmuramate--L-alanine ligase [Agrobacterium v 1 1e-163
325293464471 UDP-N-acetylmuramate-alanine ligase [Agrobacterium sp. 1 1e-162
86282551452 UDP-N-acetylmuramate--alanine ligase protein [Rhizobium 1 1e-162
162329635471 UDP-N-acetylmuramate--L-alanine ligase [Rhizobium etli 1 1e-161
190892582471 UDP-N-acetylmuramate--alanine ligase [Rhizobium etli CI 1 1e-161
218674669471 UDP-N-acetylmuramate--L-alanine ligase [Rhizobium etli 1 1e-161
150397282471 UDP-N-acetylmuramate--L-alanine ligase [Sinorhizobium m 1 1e-160
327194621471 UDP-N-acetylmuramate--alanine ligase protein [Rhizobium 1 1e-160
>gi|315122420|ref|YP_004062909.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 475 Back     alignment and organism information
 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/475 (84%), Positives = 440/475 (92%), Gaps = 1/475 (0%)

Query: 1   MLNPQGMGPIHFVGIGGIGMSGIAEVLHNTGHQVQGSDVILGPNVQRLHKQGIKVSIGHK 60
           ML P G+GPIHFVGIGGIGMSGIAEVLHNTG+QVQGSDVILGPNVQRLHKQGIKVSIGHK
Sbjct: 1   MLIPHGVGPIHFVGIGGIGMSGIAEVLHNTGYQVQGSDVILGPNVQRLHKQGIKVSIGHK 60

Query: 61  VENIDNAEILVLSTAIDKDNVECIAARERNIPIIFRSEMLAGLMRCRKSISVSGTHGKTT 120
            ENI NAEILV+STAIDKDNVEC+AARERNIPII+RSEMLAGLMR RKSISVSGTHGKTT
Sbjct: 61  EENIGNAEILVVSTAIDKDNVECVAARERNIPIIYRSEMLAGLMRARKSISVSGTHGKTT 120

Query: 121 TTSLIAALLEQGKFDPTVINGGIINSYGTNARIGTSEWIVVEADESDGTFIRLPSDIVVV 180
           TTSLIAALLEQG  DPTVINGGI+NSYGTNARIGT EWIVVEADESDGTFI+LPSDIVVV
Sbjct: 121 TTSLIAALLEQGNLDPTVINGGIVNSYGTNARIGTGEWIVVEADESDGTFIKLPSDIVVV 180

Query: 181 TNIDPEHLDYYGDFNAIRAAFYKFIDNIPFYGFAVVCMDHPEVRSLIARIQNRKIITYGR 240
           TNIDPEHLDYY DF+AIRAAFYKFIDN+PFYGFAVVC+DHPE+ SL+ARIQNRKIITYG+
Sbjct: 181 TNIDPEHLDYYSDFDAIRAAFYKFIDNVPFYGFAVVCLDHPEILSLVARIQNRKIITYGQ 240

Query: 241 HPQADIRYSNIRKYSGRSIFDVSVQGNVTKDLTVIKDLSLPLIGEHNISNACASIAVAYK 300
           HPQAD+ YSNIRKYSGRSIFDV++QG++T     IKDL LPLIG +NISNA A+IA+A++
Sbjct: 241 HPQADVCYSNIRKYSGRSIFDVTLQGSLTPTPIEIKDLVLPLIGNYNISNASAAIAIAHR 300

Query: 301 LGLSSEDVKKGLASFSGIKRRFTLVGVWNDVHVFDDYGHHPIEISSVLAAVRQICPRKII 360
           LGLSSED+ KGLA FSGIKRRFTL+G+WNDVH+FDDYGHHP+EIS+VL+AVRQICP K+I
Sbjct: 301 LGLSSEDIAKGLAGFSGIKRRFTLIGIWNDVHIFDDYGHHPVEISAVLSAVRQICPGKVI 360

Query: 361 AIHQPHRYSRLSTLFDQFSSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQ 420
           AIHQPHRY+RLSTLFDQFS CF D+D VLISPVY+AGEK I GFSS ELV+ IK  GHP+
Sbjct: 361 AIHQPHRYTRLSTLFDQFSKCFVDSDTVLISPVYAAGEKVISGFSSQELVQKIKESGHPE 420

Query: 421 AYYMDSFDHLVSKILAIAEPGDFIIFFGAGNITQWAASLIGELELVTPQ-NVCMM 474
           AYY+DSFDHLVSKIL I EPGDFIIFFGAGNITQWAASLIGELELVT Q NVCMM
Sbjct: 421 AYYLDSFDHLVSKILDIVEPGDFIIFFGAGNITQWAASLIGELELVTEQKNVCMM 475


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15889377|ref|NP_355058.1| UDP-N-acetylmuramate--L-alanine ligase [Agrobacterium tumefaciens str. C58] Length = 471 Back     alignment and organism information
>gi|222149135|ref|YP_002550092.1| UDP-N-acetylmuramate--L-alanine ligase [Agrobacterium vitis S4] Length = 471 Back     alignment and organism information
>gi|325293464|ref|YP_004279328.1| UDP-N-acetylmuramate-alanine ligase [Agrobacterium sp. H13-3] Length = 471 Back     alignment and organism information
>gi|86282551|gb|ABC91614.1| UDP-N-acetylmuramate--alanine ligase protein [Rhizobium etli CFN 42] Length = 452 Back     alignment and organism information
>gi|162329635|ref|YP_470341.2| UDP-N-acetylmuramate--L-alanine ligase [Rhizobium etli CFN 42] Length = 471 Back     alignment and organism information
>gi|190892582|ref|YP_001979124.1| UDP-N-acetylmuramate--alanine ligase [Rhizobium etli CIAT 652] Length = 471 Back     alignment and organism information
>gi|218674669|ref|ZP_03524338.1| UDP-N-acetylmuramate--L-alanine ligase [Rhizobium etli GR56] Length = 471 Back     alignment and organism information
>gi|150397282|ref|YP_001327749.1| UDP-N-acetylmuramate--L-alanine ligase [Sinorhizobium medicae WSM419] Length = 471 Back     alignment and organism information
>gi|327194621|gb|EGE61471.1| UDP-N-acetylmuramate--alanine ligase protein [Rhizobium etli CNPAF512] Length = 471 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus Libe
PRK00421461 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; 0.0
TIGR01082448 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase 1e-146
PRK14573 809 PRK14573, PRK14573, bifunctional D-alanyl-alanine synth 1e-84
TIGR01081448 TIGR01081, mpl, UDP-N-acetylmuramate:L-alanyl-gamma-D-g 7e-50
COG0771448 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate 1e-41
TIGR01087433 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutama 4e-34
COG0773459 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cel 1e-157
PRK02472447 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-30
PRK14106450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 5e-26
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-20
PRK01368454 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-19
PRK01710458 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-15
PRK04308445 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-14
PRK01438480 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 5e-14
PRK03803448 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-13
PRK00141473 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 7e-11
PRK04663438 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-06
pfam08245188 pfam08245, Mur_ligase_M, Mur ligase middle domain 6e-30
PRK01390460 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-19
PRK14016727 PRK14016, PRK14016, cyanophycin synthetase; Provisional 3e-13
PRK14093479 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutam 2e-06
COG0770451 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthas 4e-29
COG0769475 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase 3e-26
TIGR01085464 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthet 1e-24
PRK11929958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 9e-22
TIGR01143417 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-ala 1e-19
PRK11929 958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 2e-18
PRK02006498 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-13
PRK14022481 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutam 6e-08
PRK03369488 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-05
TIGR01499397 TIGR01499, folC, folylpolyglutamate synthase/dihydrofol 9e-05
PRK00139460 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate- 8e-25
TIGR02068864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 1e-17
COG0285427 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme me 2e-06
PRK04690468 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 9e-13
PRK03806438 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-06
pfam0122576 pfam01225, Mur_ligase, Mur ligase family, catalytic dom 5e-10
PRK00683418 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-04
pfam0287587 pfam02875, Mur_ligase_C, Mur ligase family, glutamate l 8e-10
PRK10773453 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alan 8e-05
PRK03815401 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-04
>gnl|CDD|179018 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162195 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|130153 TIGR01081, mpl, UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso- diaminopimelate ligase Back     alignment and domain information
>gnl|CDD|31114 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162197 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>gnl|CDD|31116 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179428 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179461 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179286 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179323 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|167786 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179297 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179650 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178896 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|149357 pfam08245, Mur_ligase_M, Mur ligase middle domain Back     alignment and domain information
>gnl|CDD|179291 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184454 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184501 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162196 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthetase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162224 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184459 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional Back     alignment and domain information
>gnl|CDD|179571 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162392 TIGR01499, folC, folylpolyglutamate synthase/dihydrofolate synthase Back     alignment and domain information
>gnl|CDD|178894 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|179872 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179651 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|144716 pfam01225, Mur_ligase, Mur ligase family, catalytic domain Back     alignment and domain information
>gnl|CDD|179086 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|145824 pfam02875, Mur_ligase_C, Mur ligase family, glutamate ligase domain Back     alignment and domain information
>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|179652 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus Libe
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 100.0
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 100.0
COG0773459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 100.0
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01081459 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso 100.0
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 100.0
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 100.0
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK10773452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 100.0
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 100.0
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
PRK11929953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 100.0
TIGR01143462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
COG0770451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 100.0
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 100.0
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 100.0
PRK10846416 bifunctional folylpolyglutamate synthase/ dihydrofolate 100.0
COG0285427 FolC Folylpolyglutamate synthase [Coenzyme metabolism] 100.0
). A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01499">TIGR01499460 folC FolC bifunctional protein; InterPro: IPR001645 Fol 99.97
KOG2525496 consensus 99.76
pfam08245188 Mur_ligase_M Mur ligase middle domain. 100.0
pfam0287587 Mur_ligase_C Mur ligase family, glutamate ligase domain 99.49
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 91.36
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.06
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 97.96
PRK13984604 putative oxidoreductase; Provisional 97.9
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 97.8
PRK098531032 putative selenate reductase subunit YgfK; Provisional 97.78
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.77
PRK12831464 putative oxidoreductase; Provisional 97.75
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.65
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.63
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.17
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.03
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 96.63
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 96.57
PRK05562222 precorrin-2 dehydrogenase; Provisional 96.41
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 96.31
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.04
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.02
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 96.0
PRK10637457 cysG siroheme synthase; Provisional 95.99
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 95.84
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 95.74
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.74
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.69
PRK09496455 trkA potassium transporter peripheral membrane componen 95.61
PRK07660283 consensus 95.55
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 95.46
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 95.43
PRK07454241 short chain dehydrogenase; Provisional 95.0
PRK09117282 consensus 94.93
PRK05867253 short chain dehydrogenase; Provisional 94.88
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.85
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 94.85
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.79
PRK13886241 conjugal transfer protein TraL; Provisional 94.76
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.7
PRK13175206 consensus 94.62
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 94.59
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 94.42
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 94.39
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 94.27
PRK06719157 precorrin-2 dehydrogenase; Validated 94.24
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 94.23
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.15
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 94.13
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 93.91
PRK08643256 acetoin reductase; Validated 93.87
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 93.81
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this 93.77
PRK13243333 glyoxylate reductase; Reviewed 93.76
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a 93.76
pfam01380131 SIS SIS domain. SIS (Sugar ISomerase) domains are found 93.7
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 93.31
PRK08278273 short chain dehydrogenase; Provisional 93.3
KOG0068406 consensus 93.26
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 93.23
PRK09590104 celB cellobiose phosphotransferase system IIB component 93.19
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 93.17
PRK07097265 gluconate 5-dehydrogenase; Provisional 93.11
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 93.05
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.05
PRK05872296 short chain dehydrogenase; Provisional 92.94
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.75
PRK07109338 short chain dehydrogenase; Provisional 92.67
PRK08213259 gluconate 5-dehydrogenase; Provisional 92.51
PRK12939250 short chain dehydrogenase; Provisional 92.35
TIGR00853142 pts-lac PTS system, lactose/cellobiose family IIB compo 92.17
PRK13180209 consensus 92.16
KOG0029501 consensus 92.13
COG1440102 CelA Phosphotransferase system cellobiose-specific comp 92.13
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 92.12
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.82
PRK07067256 sorbitol dehydrogenase; Provisional 91.81
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme 91.8
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 91.67
PRK08818373 prephenate dehydrogenase; Provisional 91.67
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.6
PRK08251248 short chain dehydrogenase; Provisional 91.59
PRK06720169 hypothetical protein; Provisional 91.37
PRK06194301 hypothetical protein; Provisional 91.24
PRK05693274 short chain dehydrogenase; Provisional 91.22
PRK08605332 D-lactate dehydrogenase; Validated 90.99
PRK05650270 short chain dehydrogenase; Provisional 90.76
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.72
PRK07523251 gluconate 5-dehydrogenase; Provisional 90.55
PRK07574385 formate dehydrogenase; Provisional 90.42
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 90.4
PRK07832272 short chain dehydrogenase; Provisional 90.32
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 90.09
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 97.72
PRK11749460 putative oxidoreductase; Provisional 97.7
PRK07417280 arogenate dehydrogenase; Reviewed 97.13
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.92
KOG0409327 consensus 96.82
COG2085211 Predicted dinucleotide-binding enzymes [General functio 96.47
PRK06545357 prephenate dehydrogenase; Validated 96.36
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 96.3
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.27
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 96.27
PRK08655441 prephenate dehydrogenase; Provisional 96.1
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 96.08
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.83
PRK08507275 prephenate dehydrogenase; Validated 95.81
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 95.79
PRK05868372 hypothetical protein; Validated 95.55
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.54
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.48
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.46
PTZ00082322 L-lactate dehydrogenase; Provisional 95.4
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 95.37
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 95.35
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.01
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 95.0
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 94.98
PTZ00117313 malate dehydrogenase; Provisional 94.54
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.46
PRK12921306 2-dehydropantoate 2-reductase; Provisional 94.44
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 94.33
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 94.33
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.17
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 94.11
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 93.97
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.93
PRK06483236 short chain dehydrogenase; Provisional 93.91
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 93.88
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 93.73
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 93.49
TIGR01692290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 93.37
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 93.28
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.03
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 93.03
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 92.91
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 92.9
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 92.73
PRK10675338 UDP-galactose-4-epimerase; Provisional 92.45
PRK08163396 salicylate hydroxylase; Provisional 92.15
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 92.13
COG0394139 Wzb Protein-tyrosine-phosphatase [Signal transduction m 91.73
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 91.57
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 91.44
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 91.36
pfam03848192 TehB Tellurite resistance protein TehB. 91.35
PRK12367250 short chain dehydrogenase; Provisional 91.14
pfam03853170 YjeF_N YjeF-related protein N-terminus. 90.78
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 90.78
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 90.63
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 90.61
PRK06223312 malate dehydrogenase; Reviewed 90.59
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 90.47
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 90.42
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.71
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 96.45
TIGR02417335 fruct_sucro_rep D-fructose-responsive transcription fac 92.31
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 90.1
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 97.44
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 96.73
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 96.55
PRK11559295 garR tartronate semialdehyde reductase; Provisional 96.52
PRK13512438 coenzyme A disulfide reductase; Provisional 96.5
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 96.36
COG2403449 Predicted GTPase [General function prediction only] 96.36
PRK05086312 malate dehydrogenase; Provisional 95.76
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 95.72
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 95.57
CHL00194319 ycf39 Ycf39; Provisional 95.54
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 95.52
KOG2012 1013 consensus 95.45
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 95.15
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 94.9
PRK09564443 coenzyme A disulfide reductase; Reviewed 94.77
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 93.43
PTZ00325313 malate dehydrogenase; Provisional 92.98
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 92.42
PRK13174212 consensus 92.35
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 91.91
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 97.2
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 93.95
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 93.72
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 92.91
PRK13940414 glutamyl-tRNA reductase; Provisional 91.88
PRK13512438 coenzyme A disulfide reductase; Provisional 91.16
PRK04965378 nitric oxide reductase; Provisional 96.8
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 96.54
PRK06847375 hypothetical protein; Provisional 95.41
PRK06217185 hypothetical protein; Validated 94.33
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.33
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 94.14
TIGR02128338 G6PI_arch bifunctional phosphoglucose/phosphomannose is 93.85
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 93.35
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 93.17
PRK06180277 short chain dehydrogenase; Provisional 93.13
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 92.94
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 92.32
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 91.95
PRK08118167 topology modulation protein; Reviewed 91.85
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.38
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phos 91.36
PRK12770350 putative glutamate synthase subunit beta; Provisional 91.3
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 91.24
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 91.18
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 91.17
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 91.13
PRK05976464 dihydrolipoamide dehydrogenase; Validated 91.05
PRK08267258 short chain dehydrogenase; Provisional 91.03
PRK08274456 tricarballylate dehydrogenase; Validated 90.83
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 90.8
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.75
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 90.34
PRK07845467 flavoprotein disulfide reductase; Reviewed 90.24
PRK07588391 hypothetical protein; Provisional 90.19
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.73
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 96.36
PRK03659602 glutathione-regulated potassium-efflux system protein K 95.44
PRK03562615 glutathione-regulated potassium-efflux system protein K 94.91
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 93.23
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.17
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 96.11
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.92
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.15
KOG0399 2142 consensus 94.02
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.22
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 92.39
PRK05439312 pantothenate kinase; Provisional 92.27
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 92.21
PRK00771433 signal recognition particle protein Srp54; Provisional 91.91
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 91.57
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 90.97
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 90.96
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 90.95
PRK13869405 plasmid-partitioning protein RepA; Provisional 90.45
PRK13566 724 anthranilate synthase; Provisional 95.88
TIGR01815 726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 95.71
PRK09496455 trkA potassium transporter peripheral membrane componen 95.61
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 95.45
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 95.41
PRK10669558 putative cation:proton antiport protein; Provisional 95.21
COG1737281 RpiR Transcriptional regulators [Transcription] 91.69
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 94.5
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 92.75
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 94.25
KOG0023360 consensus 93.81
PRK06436303 glycerate dehydrogenase; Provisional 92.88
TIGR02467210 CbiE precorrin-6y C5,15-methyltransferase (decarboxylat 92.59
PRK10416499 cell division protein FtsY; Provisional 90.41
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757 The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>COG0770 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional Back     alignment and domain information
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01499 folC FolC bifunctional protein; InterPro: IPR001645 Folylpolyglutamate synthase 6 Back     alignment and domain information
>KOG2525 consensus Back     alignment and domain information
>pfam08245 Mur_ligase_M Mur ligase middle domain Back     alignment and domain information
>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit; InterPro: IPR012744 This entry describes NirB, the large subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirD, the small subunit (IPR012748 from INTERPRO) Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13175 consensus Back     alignment and domain information
>pfam02254 TrkA_N TrkA-N domain Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR00292 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR002922 This family includes P32318 from SWISSPROT a putative thiamine biosynthetic enzyme Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>pfam01946 Thi4 Thi4 family Back     alignment and domain information
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>pfam01380 SIS SIS domain Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0068 consensus Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information