254781097

254781097

N-acetylglucosaminyl transferase

GeneID in NCBI database:8210122Locus tag:CLIBASIA_04995
Protein GI in NCBI database:254781097Protein Accession:YP_003065510.1
Gene range:-(1095357, 1096466)Protein Length:369aa
Gene description:N-acetylglucosaminyl transferase
COG prediction:[M] UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase
KEGG prediction:murG; N-acetylglucosaminyl transferase (EC:2.4.1.227); K02563 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
SEED prediction:UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
cccccEEEEEccccHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHcccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccEEEEEcHHHHcccccccEEEEcccccHHHHcccccHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHccEEEEcccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccc
cccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEcccccHHHHHcccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEEEccccccHHHHHHcHHHHHHHHHccccccccccccEEEEccccHHHHHcccccHHHHHccccccEEEEEcccHcHHHHHHHHHHHHHHccHHcccccEEEEEcccccHHHHHHHHHHcccccEEcHccccHHHHHHHccEEEEcccHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccc
MSENNVILLVAggtgghvfPAVALSHELKNRGYAVYLITDRrarsfitdfpadsIYEIVSSqvrfsnpfVFWNSLVILWKAFIASLRLIKklkpnvvvgfggyhsispLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVtgnpirsslikmkdipyqssdldqpfhllvfggsqgakvfsdivpksiALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRsgaltvseiavigrpailvpyphsvdqdqlhnayylqegggakvitenflsPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIivtgnpirsslikMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLahvkvdlv
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
***NNVI*LVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKM**********DQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVK****
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQV**********QYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
***NNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVK****
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV
MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVSSQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSSDLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDELGCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAYYLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEKLAHVKVDLV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target369 N-acetylglucosaminyl transferase [Candidatus Liberibact
315122419383 N-acetylglucosaminyl transferase [Candidatus Liberibact 1 1e-156
15965929374 N-acetylglucosaminyl transferase [Sinorhizobium melilot 1 7e-93
110634357375 N-acetylglucosaminyl transferase [Mesorhizobium sp. BNC 1 3e-91
227822651373 undecaprenyldiphospho-muramoylpentapeptide beta-N- acet 1 3e-91
222149136373 undecaprenyldiphospho-muramoylpentapeptide beta-N- acet 1 1e-89
62290324379 undecaprenyldiphospho-muramoylpentapeptide beta-N- acet 1 2e-89
237815831380 undecaprenyldiphospho-muramoylpentapeptide beta-N-acety 1 2e-89
161619379379 N-acetylglucosaminyl transferase [Brucella canis ATCC 2 1 2e-89
190892583374 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) 1 2e-89
254694115379 undecaprenyldiphospho-muramoylpentapeptide beta-N- acet 1 3e-89
>gi|315122419|ref|YP_004062908.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 383 Back     alignment and organism information
 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/362 (72%), Positives = 315/362 (87%)

Query: 1   MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVS 60
           +++ N ILLVAGGTGGHVFPAVALSHELK RGY VYL  D RA+ F+ DF  + IY + S
Sbjct: 8   LAKKNAILLVAGGTGGHVFPAVALSHELKKRGYPVYLAIDHRAQCFVEDFSPEEIYVVPS 67

Query: 61  SQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSM 120
           SQ+R SNP V + SL+ LWK FI SLRLI+KLKP V+VGFGGYH++SP+LAG+IL+IPSM
Sbjct: 68  SQIRLSNPVVIFRSLMALWKGFIVSLRLIRKLKPKVIVGFGGYHTLSPMLAGIILQIPSM 127

Query: 121 VHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSS 180
           +HEQN +MG+ANRLLSWGV++IA GL+SS+K +L  KII+TGNP+R++ IKM +IPYQ+S
Sbjct: 128 IHEQNAVMGRANRLLSWGVKVIAGGLLSSKKGLLSHKIIITGNPVRNAFIKMANIPYQAS 187

Query: 181 DLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDEL 240
             +QPF LL+FGGSQGAKVFSDI+PKSIALIP+ QR+RL+I QQV+ED+KE VQK YD+L
Sbjct: 188 YSNQPFRLLIFGGSQGAKVFSDIIPKSIALIPKEQRQRLIITQQVKEDEKEIVQKIYDDL 247

Query: 241 GCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAY 300
           G KA ++ FFKDIE+YI EANLLICRSGALTVSEIAVIGRP IL+PYPHS++QDQLHNA+
Sbjct: 248 GLKAHISSFFKDIEKYIFEANLLICRSGALTVSEIAVIGRPVILIPYPHSINQDQLHNAW 307

Query: 301 YLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEK 360
           +LQEGGGAKVIT+NFLSPERLA E+ SAMK P  LVQMAKQVSMKGK +AVL+LSDLVE+
Sbjct: 308 FLQEGGGAKVITQNFLSPERLANEISSAMKNPESLVQMAKQVSMKGKYKAVLLLSDLVEQ 367

Query: 361 LA 362
           LA
Sbjct: 368 LA 369


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965929|ref|NP_386282.1| N-acetylglucosaminyl transferase [Sinorhizobium meliloti 1021] Length = 374 Back     alignment and organism information
>gi|110634357|ref|YP_674565.1| N-acetylglucosaminyl transferase [Mesorhizobium sp. BNC1] Length = 375 Back     alignment and organism information
>gi|227822651|ref|YP_002826623.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [Sinorhizobium fredii NGR234] Length = 373 Back     alignment and organism information
>gi|222149136|ref|YP_002550093.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [Agrobacterium vitis S4] Length = 373 Back     alignment and organism information
>gi|62290324|ref|YP_222117.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [Brucella abortus bv. 1 str. 9-941] Length = 379 Back     alignment and organism information
>gi|237815831|ref|ZP_04594828.1| undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase [Brucella abortus str. 2308 A] Length = 380 Back     alignment and organism information
>gi|161619379|ref|YP_001593266.1| N-acetylglucosaminyl transferase [Brucella canis ATCC 23365] Length = 379 Back     alignment and organism information
>gi|190892583|ref|YP_001979125.1| UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosaminetransferase [Rhizobium etli CIAT 652] Length = 374 Back     alignment and organism information
>gi|254694115|ref|ZP_05155943.1| undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [Brucella abortus bv. 3 str. Tulya] Length = 379 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target369 N-acetylglucosaminyl transferase [Candidatus Liberibact
PRK00726357 PRK00726, murG, undecaprenyldiphospho-muramoylpentapept 4e-93
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylgluc 1e-76
TIGR01133348 TIGR01133, murG, undecaprenyldiphospho-muramoylpentapep 2e-72
COG1819406 COG1819, COG1819, Glycosyl transferases, related to UDP 2e-11
cd03785350 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyltrans 2e-94
pfam04101167 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 8e-25
COG4671400 COG4671, COG4671, Predicted glycosyl transferase [Gener 4e-09
pfam03033136 pfam03033, Glyco_transf_28, Glycosyltransferase family 1e-23
cd03817374 cd03817, GT1_UGDG_like, This family is most closely rel 8e-04
PRK12446352 PRK12446, PRK12446, undecaprenyldiphospho-muramoylpenta 8e-21
cd03801374 cd03801, GT1_YqgM_like, This family is most closely rel 1e-05
cd03811353 cd03811, GT1_WabH_like, This family is most closely rel 3e-05
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gtfs, a 2e-05
PLN02605382 PLN02605, PLN02605, monogalactosyldiacylglycerol syntha 0.004
>gnl|CDD|179100 PRK00726, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31051 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162217 TIGR01133, murG, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>gnl|CDD|32004 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|99961 cd03785, GT1_MurG, MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>gnl|CDD|146634 pfam04101, Glyco_tran_28_C, Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>gnl|CDD|34289 COG4671, COG4671, Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|145923 pfam03033, Glyco_transf_28, Glycosyltransferase family 28 N-terminal domain Back     alignment and domain information
>gnl|CDD|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|171505 PRK12446, PRK12446, undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|178215 PLN02605, PLN02605, monogalactosyldiacylglycerol synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 369 N-acetylglucosaminyl transferase [Candidatus Liberibact
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 100.0
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 100.0
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 100.0
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 100.0
TIGR01133368 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- 100.0
PRK13609388 diacylglycerol glucosyltransferase; Provisional 100.0
PRK13608391 diacylglycerol glucosyltransferase; Provisional 100.0
cd03784401 GT1_Gtf_like This family includes the Gtfs, a group of 100.0
TIGR01426429 MGT glycosyltransferase, MGT family; InterPro: IPR00632 99.97
COG1819406 Glycosyl transferases, related to UDP-glucuronosyltrans 99.96
PRK00025382 lpxB lipid-A-disaccharide synthase; Reviewed 99.92
COG3980318 spsG Spore coat polysaccharide biosynthesis protein, pr 99.89
COG4671400 Predicted glycosyl transferase [General function predic 99.87
pfam02684373 LpxB Lipid-A-disaccharide synthetase. This is a family 99.86
PRK10307415 predicted glycosyl transferase; Provisional 99.85
cd03814364 GT1_like_2 This family is most closely related to the G 99.85
cd03808359 GT1_cap1E_like This family is most closely related to t 99.85
cd03794394 GT1_wbuB_like This family is most closely related to th 99.84
cd03801374 GT1_YqgM_like This family is most closely related to th 99.82
cd03811353 GT1_WabH_like This family is most closely related to th 99.82
cd03820348 GT1_amsD_like This family is most closely related to th 99.82
cd04951360 GT1_WbdM_like This family is most closely related to th 99.8
cd03817374 GT1_UGDG_like This family is most closely related to th 99.79
cd03807365 GT1_WbnK_like This family is most closely related to th 99.78
cd04962371 GT1_like_5 This family is most closely related to the G 99.78
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system associat 99.78
cd03822366 GT1_ecORF704_like This family is most closely related t 99.78
PRK01021607 lpxB lipid-A-disaccharide synthase; Reviewed 99.78
cd03821375 GT1_Bme6_like This family is most closely related to th 99.77
cd03800398 GT1_Sucrose_synthase This family is most closely relate 99.77
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltransfera 99.76
cd03819355 GT1_WavL_like This family is most closely related to th 99.76
cd03798377 GT1_wlbH_like This family is most closely related to th 99.76
cd03812358 GT1_CapH_like This family is most closely related to th 99.75
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol 99.75
cd03796398 GT1_PIG-A_like This family is most closely related to t 99.75
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelope bio 99.75
cd03823359 GT1_ExpE7_like This family is most closely related to t 99.74
cd03795357 GT1_like_4 This family is most closely related to the G 99.73
cd03805392 GT1_ALG2_like This family is most closely related to th 99.7
TIGR03492396 conserved hypothetical protein. This protein family is 99.64
PRK09922361 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-gala 99.6
PRK05749423 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed 99.6
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-h 99.59
cd03818396 GT1_ExpC_like This family is most closely related to th 99.58
cd04955363 GT1_like_6 This family is most closely related to the G 99.54
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope 99.54
cd03809365 GT1_mtfB_like This family is most closely related to th 99.47
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP 99.45
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system associat 99.42
cd03802335 GT1_AviGT4_like This family is most closely related to 99.41
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell 99.31
COG1817346 Uncharacterized protein conserved in archaea [Function 99.26
PRK10125405 predicted glycosyl transferase; Provisional 99.02
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP 98.96
TIGR02149416 glgA_Coryne glycogen synthase, Corynebacterium family; 98.79
TIGR02472445 sucr_P_syn_N sucrose-phosphate synthase, putative, glyc 98.76
cd04950373 GT1_like_1 Glycosyltransferases catalyze the transfer o 98.71
cd03816415 GT1_ALG1_like This family is most closely related to th 98.54
KOG2941444 consensus 98.24
KOG1111426 consensus 97.59
TIGR00236380 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR 96.77
pfam04101167 Glyco_tran_28_C Glycosyltransferase family 28 C-termina 100.0
pfam00201501 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase. 99.84
pfam00534172 Glycos_transf_1 Glycosyl transferases group 1. Mutation 99.17
cd04949372 GT1_gtfA_like This family is most closely related to th 99.04
cd04946407 GT1_AmsK_like This family is most closely related to th 98.94
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is most cl 98.87
PRK00654476 glgA glycogen synthase; Provisional 98.81
TIGR02095517 glgA glycogen/starch synthases, ADP-glucose type; Inter 96.45
PHA01630333 putative group 1 glycosyl transferase 94.18
PRK02797358 4-alpha-L-fucosyltransferase; Provisional 93.38
TIGR02918511 TIGR02918 conserved hypothetical protein TIGR02918; Int 93.08
COG3914620 Spy Predicted O-linked N-acetylglucosamine transferase, 90.97
pfam07429361 Fuc4NAc_transf 4-alpha-L-fucosyltransferase (Fuc4NAc tr 90.64
pfam03033136 Glyco_transf_28 Glycosyltransferase family 28 N-termina 99.97
pfam08660166 Alg14 Oligosaccharide biosynthesis protein Alg14 like. 99.66
KOG3339211 consensus 97.71
PRK06849387 hypothetical protein; Provisional 96.49
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 96.26
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 95.19
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 94.95
pfam06032352 DUF917 Protein of unknown function (DUF917). This famil 94.62
pfam04413186 Glycos_transf_N 3-Deoxy-D-manno-octulosonic-acid transf 93.7
PRK12311332 rpsB 30S ribosomal protein S2; Provisional 92.69
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 91.61
TIGR03590280 PseG pseudaminic acid biosynthesis-associated protein P 99.91
TIGR00661353 MJ1255 conserved hypothetical protein; InterPro: IPR005 99.08
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases catal 98.66
pfam06258308 DUF1022 Protein of unknown function (DUF1022). This fam 98.61
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [Cell 98.3
PRK10422352 lipopolysaccharide core biosynthesis protein; Provision 98.08
COG0859334 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope 98.0
cd03789279 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyl 97.66
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 96.75
TIGR00215393 lpxB lipid-A-disaccharide synthase; InterPro: IPR003835 96.27
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 95.79
cd05844367 GT1_like_7 Glycosyltransferases catalyze the transfer o 99.63
pfam02350346 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase. This f 99.48
cd03813475 GT1_like_3 This family is most closely related to the G 99.22
PRK10017426 putative pyruvyl transferase; Provisional 98.53
cd03825365 GT1_wcfI_like This family is most closely related to th 99.62
KOG1192496 consensus 99.55
pfam04007335 DUF354 Protein of unknown function (DUF354). Members of 99.61
PRK10964322 ADP-heptose:LPS heptosyl transferase I; Provisional 97.97
PRK10916348 ADP-heptose:LPS heptosyltransferase II; Provisional 94.09
KOG3349170 consensus 99.15
COG5017161 Uncharacterized conserved protein [Function unknown] 98.56
cd03804351 GT1_wbaZ_like This family is most closely related to th 98.9
cd03806419 GT1_ALG11_like This family is most closely related to t 98.17
pfam04464186 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glyc 97.98
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis, out 96.17
pfam06925169 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase 98.03
COG4370412 Uncharacterized protein conserved in bacteria [Function 96.9
COG1887388 TagB Putative glycosyl/glycerophosphate transferases in 96.73
COG2327385 WcaK Polysaccharide pyruvyl transferase family protein 95.77
COG4641373 Uncharacterized protein conserved in bacteria [Function 95.73
KOG0853495 consensus 95.69
KOG1387465 consensus 95.65
PRK09814337 hypothetical protein; Provisional 95.11
TIGR02468 1072 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR 94.95
KOG4626966 consensus 93.56
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase CsaB. T 96.52
COG1171347 IlvA Threonine dehydratase [Amino acid transport and me 90.33
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 96.2
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 96.1
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 95.96
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 95.55
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 94.72
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 93.39
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 93.05
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 92.44
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 91.58
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 90.52
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 95.41
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 95.11
PRK07208 474 hypothetical protein; Provisional 93.92
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 93.45
PRK06847375 hypothetical protein; Provisional 93.35
PRK05993277 short chain dehydrogenase; Provisional 93.26
PRK06179270 short chain dehydrogenase; Provisional 92.62
PRK07236386 hypothetical protein; Provisional 92.33
PRK06180277 short chain dehydrogenase; Provisional 92.3
PRK09620229 hypothetical protein; Provisional 91.91
PRK06947252 glucose-1-dehydrogenase; Provisional 91.87
PRK10675338 UDP-galactose-4-epimerase; Provisional 91.62
PRK07326235 short chain dehydrogenase; Provisional 91.41
PRK12937245 short chain dehydrogenase; Provisional 91.11
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 90.87
PRK08163396 salicylate hydroxylase; Provisional 90.8
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 90.66
pfam01075249 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltr 95.14
KOG0832251 consensus 94.9
PRK05299255 rpsB 30S ribosomal protein S2; Provisional 92.47
TIGR01011227 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Rib 91.93
cd01976421 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitro 91.65
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electron tra 93.06
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the electr 90.47
PRK12377248 putative replication protein; Provisional 93.0
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 91.58
>PRK00726 murG N-acetylglucosaminyl transferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK12446 N-acetylglucosaminyl transferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; InterPro: IPR006009 The murG gene of Escherichia coli encodes the N-acetylglucosaminyltransferase, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, responsible for the final step in the formation of the lipid-linked disaccharide-pentapeptide subunit of peptidoglycan Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family; InterPro: IPR006326 These sequences belong to the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>pfam02684 LpxB Lipid-A-disaccharide synthetase Back     alignment and domain information
>PRK10307 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK10125 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family; InterPro: IPR011875 This entry describes Corynebacterium glutamicum GlgA and closely related proteins in other species Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain; InterPro: IPR012822 This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS) Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG2941 consensus Back     alignment and domain information
>KOG1111 consensus Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>pfam04101 Glyco_tran_28_C Glycosyltransferase family 28 C-terminal domain Back     alignment and domain information
>pfam00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>pfam00534 Glycos_transf_1 Glycosyl transferases group 1 Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type; InterPro: IPR011835 This family consists of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>TIGR02918 TIGR02918 conserved hypothetical protein TIGR02918; InterPro: IPR014267 Members of this entry are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam07429 Fuc4NAc_transf 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) Back     alignment and domain information
>pfam03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain Back     alignment and domain information
>pfam08660 Alg14 Oligosaccharide biosynthesis protein Alg14 like Back     alignment and domain information
>KOG3339 consensus Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>pfam06032 DUF917 Protein of unknown function (DUF917) Back     alignment and domain information
>pfam04413 Glycos_transf_N 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) Back     alignment and domain information
>PRK12311 rpsB 30S ribosomal protein S2; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004 One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1 Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein; InterPro: IPR005262 The function of this domain is unknown Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>pfam06258 DUF1022 Protein of unknown function (DUF1022) Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS) Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>pfam02571 CbiJ Precorrin-6x reductase CbiJ/CobK Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>pfam02350 Epimerase_2 UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10017 putative pyruvyl transferase; Provisional Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1192 consensus Back     alignment and domain information
>pfam04007 DUF354 Protein of unknown function (DUF354) Back     alignment and domain information
>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional Back     alignment and domain information
>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional Back     alignment and domain information
>KOG3349 consensus Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>pfam04464 Glyphos_transf CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam06925 MGDG_synth Monogalactosyldiacylglycerol (MGDG) synthase Back     alignment and domain information
>COG4370 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0853 consensus Back     alignment and domain information
>KOG1387 consensus Back     alignment and domain information
>PRK09814 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819 Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>pfam02606 LpxK Tetraacyldisaccharide-1-P 4'-kinase Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase; InterPro: IPR011848 In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase; InterPro: IPR005857 This model discriminates cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain from cysteine synthases Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>pfam04127 DFP DNA / pantothenate metabolism flavoprotein Back     alignment and domain information
>pfam01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase) Back     alignment and domain information
>KOG0832 consensus Back     alignment and domain information
>PRK05299 rpsB 30S ribosomal protein S2; Provisional Back     alignment and domain information
>TIGR01011 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information