254781098

254781098

cell division protein FtsW peptidoglycan synthesis

GeneID in NCBI database:8210123Locus tag:CLIBASIA_05000
Protein GI in NCBI database:254781098Protein Accession:YP_003065511.1
Gene range:-(1096469, 1097626)Protein Length:385aa
Gene description:cell division protein FtsW peptidoglycan synthesis
COG prediction:[D] Bacterial cell division membrane protein
KEGG prediction:cell division protein FtsW peptidoglycan synthesis; K03588 cell division protein FtsW
SEED prediction:Cell division protein FtsW
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED9 TM-Helix
HMMTOP9 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS9 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMHTSISHSSGS
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccEEEcHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccc
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccEEEEEHHHHHccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccc
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMlsfasspsvaeklglenfyfvkrhalfLIPSVIIMISfslfspknvknTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIagtsvqpsefmkpsfIIVSAWFFaeqirhpeipgnifSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHfmtgvgdsfqidssrdaiihggwfgkgpgegvikrvipdshtdFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNlhllptkgmtmpaisyggssILGICITMGYLLaltcrrpekrayeedfmhtsishssgs
mvkraergilaewfWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTsvqpsefmkPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRayeedfmhtsishssgs
MVKRAERGILAEWFWTVDWfsliaflfllglglmlsfassPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEfgiifcifilcifafiVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMHTSISHSSGS
***********EWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLAL*************************
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMH*********
******RGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAY***************
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMHTSISHSSGS
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMHTSISHSSGS
MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHALFLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQPSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWDCMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIHGGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVESNDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLALTCRRPEKRAYEEDFMHTSISHSSGS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target385 cell division protein FtsW peptidoglycan synthesis [Can
315122418382 cell division protein FtsW peptidoglycan synthesis [Can 1 0.0
325293466384 Cell division protein ftsW [Agrobacterium sp. H13-3] Le 1 1e-138
227822652384 cell division protein FtsW [Sinorhizobium fredii NGR234 1 1e-137
222086445384 cell division protein [Agrobacterium radiobacter K84] L 1 1e-136
15965930384 cell division protein FtsW peptidoglycan synthesis [Sin 1 1e-136
15889379384 cell division protein [Agrobacterium tumefaciens str. C 1 1e-135
190892584384 cell division protein [Rhizobium etli CIAT 652] Length 1 1e-135
218461091380 putative cell division protein FtsW [Rhizobium etli Kim 1 1e-134
86358451384 cell division protein [Rhizobium etli CFN 42] Length = 1 1e-133
209550175384 cell division protein FtsW [Rhizobium leguminosarum bv. 1 1e-133
>gi|315122418|ref|YP_004062907.1| cell division protein FtsW peptidoglycan synthesis [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 382 Back     alignment and organism information
 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/385 (83%), Positives = 358/385 (92%), Gaps = 3/385 (0%)

Query: 1   MVKRAERGILAEWFWTVDWFSLIAFLFLLGLGLMLSFASSPSVAEKLGLENFYFVKRHAL 60
           MVKR+ERGIL+EWFW VDWFSL+AFL LLGLGLMLSFA+SP+VAEKLGL +FYFVKRHAL
Sbjct: 1   MVKRSERGILSEWFWIVDWFSLVAFLLLLGLGLMLSFAASPAVAEKLGLGSFYFVKRHAL 60

Query: 61  FLIPSVIIMISFSLFSPKNVKNTAFILLFLSLIAMFLTLFWGVEIKGAKRWLYIAGTSVQ 120
           FL+PS+I MISFS FSP+ VKNTAFILL ++LIAM LTLFWG+EIKGAKRWLYIAGTS+Q
Sbjct: 61  FLVPSIITMISFSFFSPQKVKNTAFILLLVALIAMVLTLFWGMEIKGAKRWLYIAGTSIQ 120

Query: 121 PSEFMKPSFIIVSAWFFAEQIRHPEIPGNIFSFILFGIVIALLIAQPDFGQSILVSLIWD 180
           PSE MKPSFIIV AWFFAEQ+ HPEIPGNIFS ILFGIVI+LLIAQPDFGQS+LV  IW 
Sbjct: 121 PSELMKPSFIIVCAWFFAEQMCHPEIPGNIFSLILFGIVISLLIAQPDFGQSVLVFSIWA 180

Query: 181 CMFFITGISWLWIVVFAFLGLMSLFIAYQTMPHVAIRINHFMTGVGDSFQIDSSRDAIIH 240
           CMFFITGISWLWI+VFAF+G + LF+AYQTMPHV+IRINHFMTG+GDSFQ DSSRDAII+
Sbjct: 181 CMFFITGISWLWIIVFAFVGAIILFMAYQTMPHVSIRINHFMTGIGDSFQSDSSRDAIIN 240

Query: 241 GGWFGKGPGEGVIKRVIPDSHTDFVFSVAAEEFGIIFCIFILCIFAFIVVRSFLYSLVES 300
           GGWFGKGPGEGVIKR+IPDSHTDFVFSVAAEEFGI+FCI ILCIFAF+V+R+FLYSL ES
Sbjct: 241 GGWFGKGPGEGVIKRIIPDSHTDFVFSVAAEEFGILFCIVILCIFAFVVIRAFLYSLTES 300

Query: 301 NDFIRMAIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGICITMGYLLAL 360
           +DFIR++IFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILG+C+TMGYLLAL
Sbjct: 301 DDFIRISIFGLALQIALQAFINIGVNLHLLPTKGMTMPAISYGGSSILGMCVTMGYLLAL 360

Query: 361 TCRRPEKRAYEEDFMHTSISHSSGS 385
            CRRPEKRAY++D    + SH +GS
Sbjct: 361 MCRRPEKRAYQKD---QNYSHIAGS 382


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293466|ref|YP_004279330.1| Cell division protein ftsW [Agrobacterium sp. H13-3] Length = 384 Back     alignment and organism information
>gi|227822652|ref|YP_002826624.1| cell division protein FtsW [Sinorhizobium fredii NGR234] Length = 384 Back     alignment and organism information
>gi|222086445|ref|YP_002544979.1| cell division protein [Agrobacterium radiobacter K84] Length = 384 Back     alignment and organism information
>gi|15965930|ref|NP_386283.1| cell division protein FtsW peptidoglycan synthesis [Sinorhizobium meliloti 1021] Length = 384 Back     alignment and organism information
>gi|15889379|ref|NP_355060.1| cell division protein [Agrobacterium tumefaciens str. C58] Length = 384 Back     alignment and organism information
>gi|190892584|ref|YP_001979126.1| cell division protein [Rhizobium etli CIAT 652] Length = 384 Back     alignment and organism information
>gi|218461091|ref|ZP_03501182.1| putative cell division protein FtsW [Rhizobium etli Kim 5] Length = 380 Back     alignment and organism information
>gi|86358451|ref|YP_470343.1| cell division protein [Rhizobium etli CFN 42] Length = 384 Back     alignment and organism information
>gi|209550175|ref|YP_002282092.1| cell division protein FtsW [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 384 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target385 cell division protein FtsW peptidoglycan synthesis [Can
TIGR02614356 TIGR02614, ftsW, cell division protein FtsW 6e-79
pfam01098356 pfam01098, FTSW_RODA_SPOVE, Cell cycle protein 3e-51
TIGR02210352 TIGR02210, rodA_shape, rod shape-determining protein Ro 1e-50
TIGR02615354 TIGR02615, spoVE, stage V sporulation protein E 3e-36
PRK10774404 PRK10774, PRK10774, cell division protein FtsW; Provisi 6e-28
PRK10794370 PRK10794, PRK10794, cell wall shape-determining protein 5e-27
COG0772381 COG0772, FtsW, Bacterial cell division membrane protein 6e-64
>gnl|CDD|162950 TIGR02614, ftsW, cell division protein FtsW Back     alignment and domain information
>gnl|CDD|110122 pfam01098, FTSW_RODA_SPOVE, Cell cycle protein Back     alignment and domain information
>gnl|CDD|162763 TIGR02210, rodA_shape, rod shape-determining protein RodA Back     alignment and domain information
>gnl|CDD|131664 TIGR02615, spoVE, stage V sporulation protein E Back     alignment and domain information
>gnl|CDD|182719 PRK10774, PRK10774, cell division protein FtsW; Provisional Back     alignment and domain information
>gnl|CDD|182737 PRK10794, PRK10794, cell wall shape-determining protein; Provisional Back     alignment and domain information
>gnl|CDD|31115 COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 385 cell division protein FtsW peptidoglycan synthesis [Can
TIGR02614370 ftsW cell division protein FtsW; InterPro: IPR013437 Ft 100.0
TIGR02210416 rodA_shape rod shape-determining protein RodA; InterPro 100.0
TIGR02615356 spoVE stage V sporulation protein E; InterPro: IPR01343 100.0
PRK10774405 cell division protein FtsW; Provisional 100.0
PRK10794370 cell wall shape-determining protein; Provisional 100.0
pfam01098356 FTSW_RODA_SPOVE Cell cycle protein. This entry includes 100.0
COG0772381 FtsW Bacterial cell division membrane protein [Cell div 100.0
TIGR03097402 PEP_O_lig_1 probable O-glycosylation ligase, exosortase 96.41
COG3307424 RfaL Lipid A core - O-antigen ligase and related enzyme 95.22
>TIGR02614 ftsW cell division protein FtsW; InterPro: IPR013437 FtsW is an integral membrane protein with ten transmembrane segments Back     alignment and domain information
>TIGR02210 rodA_shape rod shape-determining protein RodA; InterPro: IPR011923 This protein is a member of the FtsW/RodA/SpoVE family Back     alignment and domain information
>TIGR02615 spoVE stage V sporulation protein E; InterPro: IPR013438 Like FtsW, SpoVE proteins are encoded in a peptidoglycan operon context, but found only in endospore-forming bacteria such as Bacillus, Geobacillus and Oceanobacillus Back     alignment and domain information
>PRK10774 cell division protein FtsW; Provisional Back     alignment and domain information
>PRK10794 cell wall shape-determining protein; Provisional Back     alignment and domain information
>pfam01098 FTSW_RODA_SPOVE Cell cycle protein Back     alignment and domain information
>COG0772 FtsW Bacterial cell division membrane protein [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03097 PEP_O_lig_1 probable O-glycosylation ligase, exosortase system type 1-associated Back     alignment and domain information
>COG3307 RfaL Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00