254781099

254781099

UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase

GeneID in NCBI database:8210124Locus tag:CLIBASIA_05005
Protein GI in NCBI database:254781099Protein Accession:YP_003065512.1
Gene range:-(1097620, 1099026)Protein Length:468aa
Gene description:UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
COG prediction:[M] UDP-N-acetylmuramoylalanine-D-glutamate ligase
KEGG prediction:murD; UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (EC:6.3.2.9); K01925 UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
SEED prediction:UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)
Pathway involved in KEGG:D-Glutamine and D-glutamate metabolism [PATH:las00471]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
cccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccEEEcccccccccccEEEEEcccccccccccHHHHHHHHccccEEEHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHccccccEEEEEcccccHHHHccccccEEEEccccHHHHHHHccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHccccccccccccccccccEEEccEEEEEcccccEEccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccEEEEEccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccEEEEEcccHHHHHHHHcccccccEEEEHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHccccccEEEHHHHHHccc
cccHHccccEEEEEEccccHHHHHHHHHHcccEEEEEccccHHHHHHHHcccEEcccccHHHHHccEEEEcccccccccccHHHHHHHHHccccEEEHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccEEEEccccccHHHccccccccEEEEEEcccEEcccccccccEEEEEEccHHHHcccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccccEEEEcccccccccccEEEcccEEEEcccEEEEHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccccccEEEEEEcccEEEEEcccccHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHccEEEEEEcccHHHHHHHHHcccccEEHccHHHHHHHHHHHHHHcccccEEEEccccccHHccccHHHHHHHHHHHHHHcccccEEEEHHHHHHccc
mklssfrnhsiavfglgrsgLSAACALkdsgvhviawddhpcaVKQAKDMgievidfreipwSIISFLVlspgialtgenaHWCVKLANQFNVEIIGDIELFVRERRfsslqspfiavtgtngkSSTVALISHVLrkngydvqlggniglpilnleyfspnrFYVIECSSYqieltptidpsigvllnispdhldrhhtLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIsrissqslqsdsdlyidesflkcsatSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFindskatnLHSVIHAFLNEKRRIYWIAgglsksddfstlFPFISKIAKAYFIGNSAMLFFhhfggkinsTLSKTLDQALKSVVRDVenvqlpsivlfspgcasfdqynNFRERGFSFMsqvseipgiEMLVDIEEERKSLW
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSpfiavtgtngkssTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQlggniglpilnlEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHsisrissqslqsdsdlYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
*KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIE*******
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [C
254781096474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus 5e-07
254781102497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 0.003
254781101472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diamino 0.016
>gi|254781096|ref|YP_003065509.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Back     alignment
 Score = 47.4 bits (111), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 125/295 (42%), Gaps = 31/295 (10%)

Query: 40  HPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDI 99
           H   +K +    +E ID  EI       LVLS   A+  +N   C+  A + N+ II   
Sbjct: 49  HKQGIKVSIGHKVENIDNAEI-------LVLS--TAIDKDNVE-CIA-ARERNIPIIFRS 97

Query: 100 ELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQL--GGNIGLPILNLEY 157
           E+     R        I+V+GT+GK++T +LI+ +L +  +D  +  GG I     N   
Sbjct: 98  EMLAGLMRCRK----SISVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYGTNAR- 152

Query: 158 FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMS 214
              + + V+E           +   I V+ NI P+HLD +           K +      
Sbjct: 153 IGTSEWIVVEADESDGTFI-RLPSDIVVVTNIDPEHLDYYGDFNAIRAAFYKFIDNIPFY 211

Query: 215 KHAIICINDHQCEK-IAYDMN-----FIGHSISRISSQSLQSDSDLYIDESFLKCSATSE 268
             A++C++  +    IA   N     +  H  + I   +++  S   I +  ++ + T +
Sbjct: 212 GFAVVCMDHPEVRSLIARIQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQGNVTKD 271

Query: 269 --VIFDFSQE-TKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIA 320
             VI D S     +HNI N   S  V  +LGL  E++K+ L S  G+  R   + 
Sbjct: 272 LTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASFSGIKRRFTLVG 326

>gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Back     alignment
 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 31/121 (25%)

Query: 116 IAVTGTNGKSSTVALISHVLRKNGY-DVQLGGNIGLPILNLEYF-------SPNRFYVIE 167
           +AVTGT+GKSS  + +  + +++G    Q+G     P   +  F       +P+  Y+ +
Sbjct: 118 LAVTGTSGKSSVASFVQQICQRSGLSSFQIG-----PTSTISSFAQDNRLTTPSPIYLAK 172

Query: 168 CSSY---------QIELTP---------TIDPSIGVLLNISPDHLDRHHTLENYVNIKKK 209
             SY          +E +           I    G   N+  DH+D H T + Y N K +
Sbjct: 173 ALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMR 232

Query: 210 I 210
           +
Sbjct: 233 L 233

>gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Back     alignment
 Score = 32.3 bits (72), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 94  EIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR--KNGYDV--QLGGNIG 149
           +++G +       R  S ++  IA+TG+ GK++T  +++  L   K  Y        +IG
Sbjct: 90  DVLGALNKLAVAARLRS-KATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIG 148

Query: 150 LPILNLEYFSPNRFYVIECSSYQIE----LTPTIDPSIGVLLNISPDHLDRHHTLENYVN 205
           +P+          F + E     +     LT  + P I V+  I+P HL     +E   +
Sbjct: 149 VPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIAS 208

Query: 206 IKKKI 210
            K +I
Sbjct: 209 AKAEI 213

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [C
315122417468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [C 1 0.0
222149138471 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [A 1 1e-114
153009072467 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [O 1 1e-111
225627884467 UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucel 1 1e-110
256160167467 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [B 1 1e-109
239832311467 UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ochrob 1 1e-109
163760792473 putative UDP-N-acetylmuramoylalanine--D-glutamate ligas 1 1e-108
306844332467 UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucel 1 1e-108
17986860467 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [B 1 1e-108
254719464467 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [B 1 1e-108
>gi|315122417|ref|YP_004062906.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 468 Back     alignment and organism information
 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/468 (72%), Positives = 389/468 (83%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           M L +FRN  IAV GLGRSGLS   ALK+SG HVIAWDDH  ++ QAKDMGIE++DFR I
Sbjct: 1   MNLKNFRNRLIAVLGLGRSGLSVVGALKNSGAHVIAWDDHSHSLTQAKDMGIEIVDFRTI 60

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS IS L++SP I LTG+ AHWCVKLANQFNVEIIGDIELFVRERRFS+  SPFIAVTG
Sbjct: 61  QWSKISSLIVSPSIPLTGDKAHWCVKLANQFNVEIIGDIELFVRERRFSTFHSPFIAVTG 120

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKSSTV LISH+L +NGYDVQLGGNIG PILNL  FS +RFYVIECSSYQI+LTPTID
Sbjct: 121 TNGKSSTVMLISHILNQNGYDVQLGGNIGNPILNLADFSSHRFYVIECSSYQIDLTPTID 180

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PSIGVLLN+S DHLDRH+TLENY  IKKK+V  S+HA+IC+ND  C+ +A DM   GHS+
Sbjct: 181 PSIGVLLNVSIDHLDRHNTLENYARIKKKLVAKSQHAVICMNDDLCKTVASDMATAGHSM 240

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           +RISSQ + SDSD YID S +KCS+TS+ IF  SQE +++N+ N+  S  VCM+LGLK++
Sbjct: 241 TRISSQPMPSDSDFYIDGSHIKCSSTSKTIFALSQEDRRYNMHNVAASIAVCMRLGLKID 300

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EIKRA+ S  GLTHRLQ IA+LG VIFINDSKATNLHSV+HAFLNEKR IYWI GGLSKS
Sbjct: 301 EIKRAISSFNGLTHRLQKIAQLGQVIFINDSKATNLHSVMHAFLNEKRVIYWIGGGLSKS 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
           DDFS +FPF+SK+AKAYFIG+SA +F HH   K+   + +TLDQAL SVVRDV N  +PS
Sbjct: 361 DDFSIIFPFLSKVAKAYFIGDSATIFAHHLREKVECDVFQTLDQALTSVVRDVVNTTIPS 420

Query: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW 468
           +VLFSPGCASFDQY NF+ERGFSFMSQVSEI  I+MLVDIEEERK  W
Sbjct: 421 VVLFSPGCASFDQYKNFKERGFSFMSQVSEIKNIQMLVDIEEERKFPW 468


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149138|ref|YP_002550095.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Agrobacterium vitis S4] Length = 471 Back     alignment and organism information
>gi|153009072|ref|YP_001370287.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ochrobactrum anthropi ATCC 49188] Length = 467 Back     alignment and organism information
>gi|225627884|ref|ZP_03785920.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella ceti str. Cudo] Length = 467 Back     alignment and organism information
>gi|256160167|ref|ZP_05457861.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ceti M490/95/1] Length = 467 Back     alignment and organism information
>gi|239832311|ref|ZP_04680640.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ochrobactrum intermedium LMG 3301] Length = 467 Back     alignment and organism information
>gi|163760792|ref|ZP_02167872.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hoeflea phototrophica DFL-43] Length = 473 Back     alignment and organism information
>gi|306844332|ref|ZP_07476924.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. BO1] Length = 467 Back     alignment and organism information
>gi|17986860|ref|NP_539494.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella melitensis bv. 1 str. 16M] Length = 467 Back     alignment and organism information
>gi|254719464|ref|ZP_05181275.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella sp. 83/13] Length = 467 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [C
PRK01390460 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-144
TIGR01087433 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutama 8e-85
PRK01368454 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-72
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-72
PRK02472447 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-62
PRK14106450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-62
PRK03803448 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-57
PRK03806438 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-54
PRK04308445 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-54
PRK01438480 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 9e-52
PRK04663438 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-49
PRK04690468 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 9e-40
PRK00683418 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-38
PRK00141473 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-36
PRK03815401 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-33
COG0771448 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate 4e-97
PRK01710458 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-36
COG0285427 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme me 1e-07
PRK03369488 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-26
PRK02006498 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-26
pfam08245188 pfam08245, Mur_ligase_M, Mur ligase middle domain 3e-26
PRK00139460 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate- 9e-17
TIGR01085464 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthet 2e-16
PRK14022481 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutam 2e-07
COG0770451 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthas 1e-21
COG0769475 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase 5e-17
PRK00421461 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; 3e-16
PRK11929 958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 2e-14
TIGR01143417 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-ala 4e-14
TIGR01082448 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase 6e-14
PRK11929958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 1e-08
PRK11930 822 PRK11930, PRK11930, putative bifunctional UDP-N-acetylm 7e-08
PRK10773453 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alan 0.002
PRK02006498 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-19
PRK03369488 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-09
COG0773459 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cel 5e-18
PRK14016727 PRK14016, PRK14016, cyanophycin synthetase; Provisional 1e-07
TIGR02068864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 3e-07
TIGR01499397 TIGR01499, folC, folylpolyglutamate synthase/dihydrofol 2e-04
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formaldehyde 5e-04
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-l 0.002
>gnl|CDD|179291 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162197 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>gnl|CDD|179286 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179461 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179428 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179650 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179651 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|167786 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179297 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179872 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179086 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178896 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179652 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31114 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179323 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|179571 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|149357 pfam08245, Mur_ligase_M, Mur ligase middle domain Back     alignment and domain information
>gnl|CDD|178894 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional Back     alignment and domain information
>gnl|CDD|162196 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthetase Back     alignment and domain information
>gnl|CDD|184459 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179018 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162224 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase Back     alignment and domain information
>gnl|CDD|162195 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|183386 PRK11930, PRK11930, putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179571 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31116 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184454 PRK14016, PRK14016, cyanophycin synthetase; Provisional Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|162392 TIGR01499, folC, folylpolyglutamate synthase/dihydrofolate synthase Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [C
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 100.0
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 100.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 100.0
TIGR01081459 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso 100.0
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 100.0
COG0773459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 91.86
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 100.0
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 100.0
PRK10773452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
TIGR01143462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 100.0
COG0770451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 100.0
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 100.0
COG0285427 FolC Folylpolyglutamate synthase [Coenzyme metabolism] 99.94
PRK11929953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 100.0
PRK10846416 bifunctional folylpolyglutamate synthase/ dihydrofolate 99.95
pfam08245188 Mur_ligase_M Mur ligase middle domain. 99.98
). A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01499">TIGR01499460 folC FolC bifunctional protein; InterPro: IPR001645 Fol 99.91
KOG2525496 consensus 99.53
pfam0287587 Mur_ligase_C Mur ligase family, glutamate ligase domain 98.51
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 97.63
PRK13984604 putative oxidoreductase; Provisional 98.13
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.09
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 97.94
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.89
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.86
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 97.82
PRK07417280 arogenate dehydrogenase; Reviewed 97.81
PRK098531032 putative selenate reductase subunit YgfK; Provisional 97.79
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.72
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.67
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.56
PRK08507275 prephenate dehydrogenase; Validated 97.54
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 97.46
PRK13243333 glyoxylate reductase; Reviewed 97.27
KOG0029501 consensus 97.27
KOG0068406 consensus 97.26
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 97.25
KOG0409327 consensus 97.25
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 97.23
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.23
PRK06500249 short chain dehydrogenase; Provisional 97.21
PRK07060245 short chain dehydrogenase; Provisional 97.19
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.19
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.19
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 97.17
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 97.17
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 97.16
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 97.08
PRK06545357 prephenate dehydrogenase; Validated 97.06
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 96.99
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 96.99
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.99
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 96.98
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 96.93
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 96.92
PRK07814263 short chain dehydrogenase; Provisional 96.91
PRK07062265 short chain dehydrogenase; Provisional 96.9
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.89
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 96.86
CHL00194319 ycf39 Ycf39; Provisional 96.82
PRK12939250 short chain dehydrogenase; Provisional 96.8
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 96.79
PRK09072262 short chain dehydrogenase; Provisional 96.77
PRK07576260 short chain dehydrogenase; Provisional 96.76
PRK05867253 short chain dehydrogenase; Provisional 96.73
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 96.72
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; Int 96.71
PRK08936261 glucose-1-dehydrogenase; Provisional 96.7
PRK06182273 short chain dehydrogenase; Validated 96.69
PRK05993277 short chain dehydrogenase; Provisional 96.67
PRK12746254 short chain dehydrogenase; Provisional 96.67
PRK08655441 prephenate dehydrogenase; Provisional 96.66
PRK08628258 short chain dehydrogenase; Provisional 96.64
PRK06124259 gluconate 5-dehydrogenase; Provisional 96.6
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.6
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 96.59
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 96.58
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.56
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.53
PRK07825273 short chain dehydrogenase; Provisional 96.51
PRK05872296 short chain dehydrogenase; Provisional 96.5
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.44
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.41
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 96.4
PRK12744257 short chain dehydrogenase; Provisional 96.4
PRK09496455 trkA potassium transporter peripheral membrane componen 96.33
PRK06194301 hypothetical protein; Provisional 96.3
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 96.28
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.27
PRK05876275 short chain dehydrogenase; Provisional 96.27
PTZ00117313 malate dehydrogenase; Provisional 96.16
PRK12367250 short chain dehydrogenase; Provisional 96.14
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 96.1
PRK08265261 short chain dehydrogenase; Provisional 96.09
TIGR00872341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 96.09
PRK08277278 D-mannonate oxidoreductase; Provisional 96.09
PRK06932314 glycerate dehydrogenase; Provisional 96.08
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.08
PRK06172253 short chain dehydrogenase; Provisional 96.06
PRK07677254 short chain dehydrogenase; Provisional 96.06
PRK08605332 D-lactate dehydrogenase; Validated 96.06
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.05
PRK06487317 glycerate dehydrogenase; Provisional 96.05
PRK08017256 short chain dehydrogenase; Provisional 96.03
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 95.99
PRK08085254 gluconate 5-dehydrogenase; Provisional 95.98
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 95.95
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 95.92
PRK09134256 short chain dehydrogenase; Provisional 95.91
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 95.91
PRK06114262 short chain dehydrogenase; Provisional 95.85
PRK07774250 short chain dehydrogenase; Provisional 95.83
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 95.78
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 95.77
PRK13403335 ketol-acid reductoisomerase; Provisional 95.76
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.75
PTZ00082322 L-lactate dehydrogenase; Provisional 95.73
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 95.72
PRK06101241 short chain dehydrogenase; Provisional 95.71
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 95.7
PRK07067256 sorbitol dehydrogenase; Provisional 95.68
PRK05479336 ketol-acid reductoisomerase; Provisional 95.68
PRK12747252 short chain dehydrogenase; Provisional 95.68
PRK05693274 short chain dehydrogenase; Provisional 95.65
PRK07832272 short chain dehydrogenase; Provisional 95.63
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.63
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 95.6
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 95.58
PRK07109338 short chain dehydrogenase; Provisional 95.57
PRK07478254 short chain dehydrogenase; Provisional 95.51
PRK07806248 short chain dehydrogenase; Provisional 95.5
PRK07776252 consensus 95.49
PRK06720169 hypothetical protein; Provisional 95.48
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 95.47
pfam07991165 IlvN Acetohydroxy acid isomeroreductase, catalytic doma 95.45
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 95.45
PRK06914280 short chain dehydrogenase; Provisional 95.41
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 95.4
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.34
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.33
PRK04148135 hypothetical protein; Provisional 95.3
PRK06483236 short chain dehydrogenase; Provisional 95.28
PRK12937245 short chain dehydrogenase; Provisional 95.27
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 95.27
PRK07680273 late competence protein ComER; Validated 95.26
PRK05866290 short chain dehydrogenase; Provisional 95.25
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.24
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 95.23
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 95.23
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 95.18
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.14
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid transport 95.13
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 95.12
COG2085211 Predicted dinucleotide-binding enzymes [General functio 95.12
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.05
TIGR01692290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 95.04
PRK07454241 short chain dehydrogenase; Provisional 94.99
PRK07890258 short chain dehydrogenase; Provisional 94.95
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 94.95
PRK08226263 short chain dehydrogenase; Provisional 94.94
PRK08589272 short chain dehydrogenase; Validated 94.94
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 94.86
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 94.84
PRK06701289 short chain dehydrogenase; Provisional 94.84
PRK06346251 consensus 94.8
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.73
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.72
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 94.72
KOG2380480 consensus 94.69
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.65
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 94.51
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 94.48
PRK06227256 consensus 94.48
PRK06949258 short chain dehydrogenase; Provisional 94.48
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.36
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 94.34
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 94.28
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 94.24
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 94.21
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 94.18
PRK08643256 acetoin reductase; Validated 94.12
PRK06180277 short chain dehydrogenase; Provisional 94.1
PRK05225489 ketol-acid reductoisomerase; Validated 94.07
PRK12921306 2-dehydropantoate 2-reductase; Provisional 94.02
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 93.95
PRK10206345 putative dehydrogenase; Provisional 93.78
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a 93.77
TIGR00936422 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-aden 93.74
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.72
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.7
PRK06947252 glucose-1-dehydrogenase; Provisional 93.67
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 93.65
PRK11579346 putative oxidoreductase; Provisional 93.65
PRK00048265 dihydrodipicolinate reductase; Provisional 93.65
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 93.63
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 93.57
PRK08040337 putative semialdehyde dehydrogenase; Provisional 93.19
PRK06482276 short chain dehydrogenase; Provisional 93.19
COG2910211 Putative NADH-flavin reductase [General function predic 93.14
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 93.13
PRK06128300 oxidoreductase; Provisional 93.11
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 93.04
PRK08219226 short chain dehydrogenase; Provisional 93.02
PRK06223312 malate dehydrogenase; Reviewed 93.02
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 92.97
PRK08267258 short chain dehydrogenase; Provisional 92.89
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 92.77
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 92.72
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 92.68
PRK06953222 short chain dehydrogenase; Provisional 92.63
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 92.59
PRK08177225 short chain dehydrogenase; Provisional 92.56
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.55
PRK08263275 short chain dehydrogenase; Provisional 92.49
PRK06484530 short chain dehydrogenase; Validated 92.49
PRK07707239 consensus 92.41
PRK12938246 acetyacetyl-CoA reductase; Provisional 92.39
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 92.35
PRK07024256 short chain dehydrogenase; Provisional 92.34
PRK07775275 short chain dehydrogenase; Provisional 92.34
PRK12824245 acetoacetyl-CoA reductase; Provisional 92.33
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 92.17
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding 92.15
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 92.12
PRK07074256 short chain dehydrogenase; Provisional 92.1
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.09
PRK08294 634 phenol 2-monooxygenase; Provisional 91.97
KOG0023360 consensus 91.96
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phos 91.89
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 97.97
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 97.81
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 97.7
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 97.63
PRK11559295 garR tartronate semialdehyde reductase; Provisional 97.55
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 97.53
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.52
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.46
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 97.45
PRK07574385 formate dehydrogenase; Provisional 97.36
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.3
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.29
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.19
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 97.13
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 97.09
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 97.09
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 97.05
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 96.99
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 96.98
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 96.94
PRK06719157 precorrin-2 dehydrogenase; Validated 96.66
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 96.64
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 96.57
KOG0685498 consensus 96.52
PRK06198268 short chain dehydrogenase; Provisional 96.43
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 96.42
PRK10637457 cysG siroheme synthase; Provisional 96.41
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 96.09
PRK05562222 precorrin-2 dehydrogenase; Provisional 95.87
PTZ00325313 malate dehydrogenase; Provisional 95.23
COG2403449 Predicted GTPase [General function prediction only] 95.03
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 94.03
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 92.62
PRK08674328 bifunctional phosphoglucose/phosphomannose isomerase; V 92.07
KOG1201300 consensus 91.94
KOG1209289 consensus 91.92
PRK12831464 putative oxidoreductase; Provisional 97.82
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 97.79
PRK11749460 putative oxidoreductase; Provisional 97.73
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 97.24
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 97.16
PRK12742237 oxidoreductase; Provisional 97.03
PRK06125259 short chain dehydrogenase; Provisional 97.03
PRK05868372 hypothetical protein; Validated 96.97
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 96.93
PRK07208474 hypothetical protein; Provisional 96.9
PRK07236386 hypothetical protein; Provisional 96.89
PRK12480330 D-lactate dehydrogenase; Provisional 96.84
PRK06847375 hypothetical protein; Provisional 96.79
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 96.75
PRK04965378 nitric oxide reductase; Provisional 96.74
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 96.73
PRK07523251 gluconate 5-dehydrogenase; Provisional 96.69
PRK06436303 glycerate dehydrogenase; Provisional 96.63
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 96.62
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 96.57
PRK06398256 aldose dehydrogenase; Validated 96.5
PRK12829264 short chain dehydrogenase; Provisional 96.45
PRK11883452 protoporphyrinogen oxidase; Reviewed 96.45
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.43
PRK08163396 salicylate hydroxylase; Provisional 96.4
PRK07233430 hypothetical protein; Provisional 96.34
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 96.32
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.3
PRK07041240 short chain dehydrogenase; Provisional 96.26
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 96.26
PRK06841255 short chain dehydrogenase; Provisional 96.26
PRK06753373 hypothetical protein; Provisional 96.25
PRK13512438 coenzyme A disulfide reductase; Provisional 96.23
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.21
PRK07588391 hypothetical protein; Provisional 96.18
PRK12770350 putative glutamate synthase subunit beta; Provisional 96.17
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.11
PRK08703239 short chain dehydrogenase; Provisional 96.1
PRK08339263 short chain dehydrogenase; Provisional 96.07
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 96.06
PRK05875277 short chain dehydrogenase; Provisional 96.05
PRK08862227 short chain dehydrogenase; Provisional 96.03
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.02
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.01
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 96.01
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.01
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.0
PRK07660283 consensus 95.94
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 95.92
PRK07538413 hypothetical protein; Provisional 95.92
PRK06475400 salicylate hydroxylase; Provisional 95.9
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.89
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.88
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 95.86
PRK07045388 putative monooxygenase; Reviewed 95.83
PRK09117282 consensus 95.78
PRK07831261 short chain dehydrogenase; Provisional 95.78
PRK07856254 short chain dehydrogenase; Provisional 95.77
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.75
PRK07063259 short chain dehydrogenase; Provisional 95.71
PRK07035252 short chain dehydrogenase; Provisional 95.7
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.68
COG3349485 Uncharacterized conserved protein [Function unknown] 95.68
PRK09242258 tropinone reductase; Provisional 95.64
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.62
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 95.56
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.51
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 95.49
PRK08278273 short chain dehydrogenase; Provisional 95.48
KOG1399448 consensus 95.44
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 95.4
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 95.38
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 95.36
PRK08328230 hypothetical protein; Provisional 95.31
PRK09291257 short chain dehydrogenase; Provisional 95.31
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 95.27
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 95.26
PRK06126545 hypothetical protein; Provisional 95.25
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 95.18
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 95.18
PRK07985294 oxidoreductase; Provisional 95.17
PRK06057255 short chain dehydrogenase; Provisional 95.16
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 95.15
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 95.14
PRK12827251 short chain dehydrogenase; Provisional 95.11
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.11
PRK07479252 consensus 95.07
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 95.05
PRK08945245 short chain dehydrogenase; Provisional 95.0
PRK12828239 short chain dehydrogenase; Provisional 94.95
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 94.95
PRK07608389 hypothetical protein; Provisional 94.94
PRK06184503 hypothetical protein; Provisional 94.93
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 94.92
PRK07326235 short chain dehydrogenase; Provisional 94.86
PRK09186255 flagellin modification protein A; Provisional 94.81
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 94.78
PRK08251248 short chain dehydrogenase; Provisional 94.77
PRK09126392 hypothetical protein; Provisional 94.77
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this 94.74
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 94.73
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 94.73
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 94.73
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 94.71
PRK06179270 short chain dehydrogenase; Provisional 94.7
PRK09564443 coenzyme A disulfide reductase; Reviewed 94.67
PRK06138252 short chain dehydrogenase; Provisional 94.66
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.58
PRK06139324 short chain dehydrogenase; Provisional 94.57
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 94.56
PRK05855582 short chain dehydrogenase; Validated 94.55
PRK06185409 hypothetical protein; Provisional 94.55
KOG2614420 consensus 94.51
PRK05717255 oxidoreductase; Validated 94.5
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 94.49
PRK06834488 hypothetical protein; Provisional 94.43
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 94.42
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 94.4
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 94.4
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 94.4
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 94.38
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 94.35
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 94.31
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 94.31
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 94.23
PRK08244494 hypothetical protein; Provisional 94.21
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 94.21
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of amino a 94.2
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.12
PRK12416466 protoporphyrinogen oxidase; Provisional 94.09
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.08
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 93.99
PRK08132549 hypothetical protein; Provisional 93.92
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 93.91
PRK07102243 short chain dehydrogenase; Provisional 93.87
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 93.86
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.86
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 93.85
PRK08774402 consensus 93.83
PRK07791285 short chain dehydrogenase; Provisional 93.83
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 93.71
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 93.65
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 93.53
PRK07190480 hypothetical protein; Provisional 93.4
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 93.36
PRK08013400 hypothetical protein; Provisional 93.36
PRK10262321 thioredoxin reductase; Provisional 93.27
PRK08264235 short chain dehydrogenase; Validated 93.21
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 93.13
PRK06181263 short chain dehydrogenase; Provisional 93.05
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 93.04
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 92.99
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 92.84
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 92.82
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 92.81
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 92.71
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 92.45
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 92.38
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 92.37
PRK08303305 short chain dehydrogenase; Provisional 92.27
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 92.24
PRK07577234 short chain dehydrogenase; Provisional 92.23
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.18
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 92.08
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 91.95
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.83
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 91.79
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.8
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 97.43
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 96.44
KOG0069336 consensus 95.93
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 97.71
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.08
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 95.82
PRK09422338 alcohol dehydrogenase; Provisional 93.92
PRK03659602 glutathione-regulated potassium-efflux system protein K 97.47
PRK03562615 glutathione-regulated potassium-efflux system protein K 97.35
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.22
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.22
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.05
PRK13771332 putative alcohol dehydrogenase; Provisional 95.06
KOG0022375 consensus 94.04
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 96.62
PRK13940414 glutamyl-tRNA reductase; Provisional 96.35
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.24
PRK13566 724 anthranilate synthase; Provisional 95.23
PRK11557282 putative DNA-binding transcriptional regulator; Provisi 93.51
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.6
KOG0399 2142 consensus 95.96
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 94.33
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 94.09
PRK13869405 plasmid-partitioning protein RepA; Provisional 93.92
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 93.78
PRK05439312 pantothenate kinase; Provisional 93.08
PRK03839180 putative kinase; Provisional 92.34
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 92.31
PRK10416499 cell division protein FtsY; Provisional 91.82
cd02040270 NifH NifH gene encodes component II (iron protein) of n 91.72
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 96.52
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 91.84
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 96.3
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 96.23
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 95.77
PRK09496455 trkA potassium transporter peripheral membrane componen 95.9
PTZ00079469 NADP-specific glutamate dehydrogenase; Provisional 94.98
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol 95.42
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 95.13
PRK10537356 voltage-gated potassium channel; Provisional 93.02
PRK10083339 putative dehydrogenase; Provisional 92.61
PRK08324 676 short chain dehydrogenase; Validated 95.04
KOG0024354 consensus 94.36
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 92.96
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.78
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 92.55
cd01424110 MGS_CPS_II Methylglyoxal synthase-like domain from type 92.26
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757 The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information