254781100

254781100

phospho-N-acetylmuramoyl-pentapeptide-transferase

GeneID in NCBI database:8210125Locus tag:CLIBASIA_05010
Protein GI in NCBI database:254781100Protein Accession:YP_003065513.1
Gene range:-(1099034, 1100134)Protein Length:366aa
Gene description:phospho-N-acetylmuramoyl-pentapeptide- transferase
COG prediction:[M] UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase
KEGG prediction:mraY; phospho-N-acetylmuramoyl-pentapeptide-transferase (EC:2.7.8.13); K01000 phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
SEED prediction:Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM10 TM-Helix
TOPPRED10 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM10 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
cHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccEcccccccHHHHccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEHcccccccccccHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcHcHHHHHHHcccEEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccccHEEEEEHHHHccccHHHHccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHccccccHEEHHHHHHHHHHHHHHHHHHccc
mfiqladfseYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLqefrgqpvrvpnlpiharkidtptmGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFglvgfyddyikittgdagglsgKVRILIEFIIAILAVCALLFYSnstllgietktsivFPFFRDIILDMGLFFIPFAAFVIVATANAvnltdgldglaIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIgflwfnispavifmgdtgslaLGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMApihhhfekkgwteNQIVIRFWIISFIFAVIGLLTLKMR
mfiqladfSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEfrgqpvrvpnlpiharkidTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTmggiiilmgligssllWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLffipfaafvivataNAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEilliiigglFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR
MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Cand
315122416366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Cand 1 1e-155
190892586366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhiz 1 1e-123
86358453366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhiz 1 1e-122
116253051366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhiz 1 1e-122
209550177366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhiz 1 1e-122
163760793367 phospho-N-acetylmuramoyl-pentapeptide-transferase [Hoef 1 1e-122
222149139366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Agro 1 1e-122
227822654366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Sino 1 1e-122
260462087360 phospho-N-acetylmuramoyl-pentapeptide-transferase [Meso 1 1e-121
319782845360 phospho-N-acetylmuramoyl-pentapeptide-transferase [Meso 1 1e-121
>gi|315122416|ref|YP_004062905.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 366 Back     alignment and organism information
 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 269/366 (73%), Positives = 313/366 (85%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MFI+LADFSEY++I ++ KY+TFRSSAAF S++ IV A GPK+ID L S Q  +GQP RV
Sbjct: 1   MFIRLADFSEYHVILNIFKYITFRSSAAFLSSVFIVLAIGPKIIDLLHSFQGEKGQPARV 60

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
            +LPIHA+KI  PTMGGI+IL+G+IGSSLLWAD SSLHV +IL LT+ FGLVGF DDY+K
Sbjct: 61  SDLPIHAKKIGVPTMGGIMILVGIIGSSLLWADMSSLHVKVILFLTIGFGLVGFCDDYMK 120

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           I TGD  GLS K+RI +E ++A  AVCALLFYS S+L  +ET TSI FPFF+D ILD+G+
Sbjct: 121 IKTGDKKGLSWKIRIAVELVLATFAVCALLFYSKSSLFNVETTTSITFPFFKDFILDIGM 180

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAA VIVATANAVNLTDGLD LAIV VMIAS AFS I YVAGNI+ SHYLQ++FVP
Sbjct: 181 FFIPFAALVIVATANAVNLTDGLDSLAIVLVMIASAAFSIITYVAGNIVFSHYLQISFVP 240

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           GVGELVV+ISALIGAG+GFLWFN  PA +FMGDTGSLALGA IGGIAVSTKHE+++IIIG
Sbjct: 241 GVGELVVIISALIGAGLGFLWFNAPPASVFMGDTGSLALGALIGGIAVSTKHEVVMIIIG 300

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           G+FVVE LSVI+Q+ YFKMT +R FLMAPIHHHFEKKGW E+QI+IRFWI + I AV+GL
Sbjct: 301 GVFVVEILSVIIQILYFKMTGRRFFLMAPIHHHFEKKGWAESQIIIRFWIFAIILAVVGL 360

Query: 361 LTLKMR 366
           LTLKMR
Sbjct: 361 LTLKMR 366


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892586|ref|YP_001979128.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium etli CIAT 652] Length = 366 Back     alignment and organism information
>gi|86358453|ref|YP_470345.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium etli CFN 42] Length = 366 Back     alignment and organism information
>gi|116253051|ref|YP_768889.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium leguminosarum bv. viciae 3841] Length = 366 Back     alignment and organism information
>gi|209550177|ref|YP_002282094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 366 Back     alignment and organism information
>gi|163760793|ref|ZP_02167873.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hoeflea phototrophica DFL-43] Length = 367 Back     alignment and organism information
>gi|222149139|ref|YP_002550096.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium vitis S4] Length = 366 Back     alignment and organism information
>gi|227822654|ref|YP_002826626.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium fredii NGR234] Length = 366 Back     alignment and organism information
>gi|260462087|ref|ZP_05810331.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium opportunistum WSM2075] Length = 360 Back     alignment and organism information
>gi|319782845|ref|YP_004142321.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 360 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Cand
PRK00108344 PRK00108, mraY, phospho-N-acetylmuramoyl-pentapeptide-t 1e-122
TIGR00445321 TIGR00445, mraY, phospho-N-acetylmuramoyl-pentapeptide- 1e-90
COG0472319 COG0472, Rfe, UDP-N-acetylmuramyl pentapeptide phosphot 2e-44
PRK14654302 PRK14654, mraY, phospho-N-acetylmuramoyl-pentapeptide-t 5e-37
PRK14655304 PRK14655, mraY, phospho-N-acetylmuramoyl-pentapeptide-t 4e-29
cd06856280 cd06856, GT_GPT_archaea, UDP-GlcNAc:dolichol-P GlcNAc-1 2e-19
cd06852280 cd06852, GT_MraY, Phospho-N-acetylmuramoyl-pentapeptide 1e-92
cd06853249 cd06853, GT_WecA_like, This subfamily contains Escheric 2e-23
cd06499185 cd06499, GT_MraY-like, Glycosyltransferase 4 (GT4) incl 3e-23
pfam00953158 pfam00953, Glycos_transf_4, Glycosyl transferase family 3e-21
cd06854253 cd06854, GT_WbpL_WbcO_like, The members of this subfami 4e-20
cd06912193 cd06912, GT_MraY_like, This subfamily is composed of un 4e-15
cd06851223 cd06851, GT_GPT_like, This family includes eukaryotic U 7e-04
>gnl|CDD|178869 PRK00108, mraY, phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional Back     alignment and domain information
>gnl|CDD|161884 TIGR00445, mraY, phospho-N-acetylmuramoyl-pentapeptide-transferase Back     alignment and domain information
>gnl|CDD|30820 COG0472, Rfe, UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|173117 PRK14654, mraY, phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional Back     alignment and domain information
>gnl|CDD|173118 PRK14655, mraY, phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional Back     alignment and domain information
>gnl|CDD|133466 cd06856, GT_GPT_archaea, UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT)-like proteins in archaea Back     alignment and domain information
>gnl|CDD|133462 cd06852, GT_MraY, Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan Back     alignment and domain information
>gnl|CDD|133463 cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins Back     alignment and domain information
>gnl|CDD|133460 cd06499, GT_MraY-like, Glycosyltransferase 4 (GT4) includes both eukaryotic and prokaryotic UDP-D-N-acetylhexosamine:polyprenol phosphate D-N-acetylhexosamine-1-phosphate transferases Back     alignment and domain information
>gnl|CDD|144520 pfam00953, Glycos_transf_4, Glycosyl transferase family 4 Back     alignment and domain information
>gnl|CDD|133464 cd06854, GT_WbpL_WbcO_like, The members of this subfamily catalyze the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate (Und-P) molecule and N-acetylhexosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylhexosamine precursor Back     alignment and domain information
>gnl|CDD|133467 cd06912, GT_MraY_like, This subfamily is composed of uncharacterized bacterial glycosyltransferases in the MraY-like family Back     alignment and domain information
>gnl|CDD|133461 cd06851, GT_GPT_like, This family includes eukaryotic UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) and archaeal GPT-like glycosyltransferases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 366 phospho-N-acetylmuramoyl-pentapeptide-transferase [Cand
TIGR00445336 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase; 100.0
PRK00108336 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase; 100.0
COG0472319 Rfe UDP-N-acetylmuramyl pentapeptide phosphotransferase 100.0
cd06856280 GT_GPT_archaea UDP-GlcNAc:dolichol-P GlcNAc-1-P transfe 100.0
TIGR02380349 ECA_wecA undecaprenyl-phosphate alpha-N-acetylglucosami 100.0
cd06854253 GT_WbpL_WbcO_like The members of this subfamily catalyz 100.0
cd06852280 GT_MraY Phospho-N-acetylmuramoyl-pentapeptide-transfera 100.0
cd06853249 GT_WecA_like This subfamily contains Escherichia coli W 100.0
cd06855283 GT_GPT_euk UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase 100.0
cd06851223 GT_GPT_like This family includes eukaryotic UDP-GlcNAc: 100.0
cd06499185 GT_MraY-like Glycosyltransferase 4 (GT4) includes both 100.0
cd06912193 GT_MraY_like This subfamily is composed of uncharacteri 100.0
pfam00953158 Glycos_transf_4 Glycosyl transferase family 4. 100.0
KOG2788418 consensus 99.78
pfam1055526 MraY_sig1 Phospho-N-acetylmuramoyl-pentapeptide-transfe 93.0
>TIGR00445 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase; InterPro: IPR003524 Phospho-N-acetylmuramoyl-pentapeptide-transferase (2 Back     alignment and domain information
>PRK00108 mraY phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional Back     alignment and domain information
>COG0472 Rfe UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06856 GT_GPT_archaea UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT)-like proteins in archaea Back     alignment and domain information
>TIGR02380 ECA_wecA undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase; InterPro: IPR012750 Members of this family are the WecA enzymes of enterobacterial common antigen (ECA) biosynthesis, undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase Back     alignment and domain information
>cd06854 GT_WbpL_WbcO_like The members of this subfamily catalyze the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate (Und-P) molecule and N-acetylhexosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylhexosamine precursor Back     alignment and domain information
>cd06852 GT_MraY Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan Back     alignment and domain information
>cd06853 GT_WecA_like This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins Back     alignment and domain information
>cd06855 GT_GPT_euk UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) catalyzes the transfer of GlcNAc-1-P from UDP-GlcNAc to dolichol-P to form GlcNAc-P-P-dolichol Back     alignment and domain information
>cd06851 GT_GPT_like This family includes eukaryotic UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) and archaeal GPT-like glycosyltransferases Back     alignment and domain information
>cd06499 GT_MraY-like Glycosyltransferase 4 (GT4) includes both eukaryotic and prokaryotic UDP-D-N-acetylhexosamine:polyprenol phosphate D-N-acetylhexosamine-1-phosphate transferases Back     alignment and domain information
>cd06912 GT_MraY_like This subfamily is composed of uncharacterized bacterial glycosyltransferases in the MraY-like family Back     alignment and domain information
>pfam00953 Glycos_transf_4 Glycosyl transferase family 4 Back     alignment and domain information
>KOG2788 consensus Back     alignment and domain information
>pfam10555 MraY_sig1 Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00