254781101

254781101

UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase

GeneID in NCBI database:8210126Locus tag:CLIBASIA_05015
Protein GI in NCBI database:254781101Protein Accession:YP_003065514.1
Gene range:-(1100178, 1101596)Protein Length:472aa
Gene description:UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase
COG prediction:[M] UDP-N-acetylmuramyl pentapeptide synthase
KEGG prediction:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate/D-alanyl-D -alanyl ligase; K01929 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D -alanyl-D-alanine ligase [EC:6.3.2.10]
SEED prediction:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
ccccccHHHHHHHccccccccccccEEEEEEEEEEEcccccEEEEEccccccHHHHHHHHHHcccEEEEEccHHccccccccccEEEEHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHccccccEEEEEEEcccccHHHHHHccccccEEEEccccHHHHHHcccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccccEEEEEEEEEccccEEEEEEEccEEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHccccc
ccccccHHHHHHHHcccccccccccEEEEEEEcccccccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccccccccccEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccEEEEcccccccccccEEEEcccccccEEEEEEccccHHHHHHHHHHccccHEEEEcHHHHHHHccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHcccccEEEEEcccccccEEEcEEEEcccccEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHccccccccEEEEEEcHHHHcHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHccccccEEEcccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHccccc
MNPLWTFHDLLQAIqghsigivpqgfvngisidsrsiapqeaffaikgphydghdFILHAVQKGAGLVVVNTDMVASigslsipvfgvdDVLGALNKLAVAARLRSKATIIAITgsvgktttKEMLTIALSSIKKTYACIgsynnhigvpltlarmpvdvdFGIFELGMSHLGEIRFLTHLVRPHIAVITTiapahlsnfsGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYsfgksknadfqlrkwkqcSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSvfhpkegrgkryRCALNQGFFTLIdesynanpASMKAAISVLSqisphgegrrIAVLGdmcemgelsqSFHIDLAEVLSLYNISHVWLSGFHVLALkdalprsihvhySETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIaitgsvgktttkeMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSvfhpkegrgkrYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPA**
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
*NPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ
MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
254781102497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 3e-09
254781096474 UDP-N-acetylmuramate--L-alanine ligase [Candidatus 1e-05
254780858425 NADH dehydrogenase I subunit F [Candidatus Liberib 0.001
254781099468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 0.018
>gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Back     alignment
 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 153/376 (40%), Gaps = 42/376 (11%)

Query: 27  VNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNT-----DMVASIGSL 81
           +N +S DSR I     F AI G   DGH FI  A+ +GA  +VV++     D  A+I S 
Sbjct: 30  INEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRS- 88

Query: 82  SIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLT-----IALSSIK-K 135
           + P+  VD+    L+  A     +    I+A+TG+ GK++    +        LSS +  
Sbjct: 89  NTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIG 148

Query: 136 TYACIGSY--NNHIGV--PLTLAR----------MPVDVDFGIFELGMSHLGEIRFLTHL 181
             + I S+  +N +    P+ LA+            V V+     L    L  I+ +   
Sbjct: 149 PTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIA-- 206

Query: 182 VRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEG-LEKTGTIFLNYDDSFFELLKAKSH 240
                   T +   H+      +   +AK  +FE  L K     +  DD++ + +  ++H
Sbjct: 207 -----GSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAH 261

Query: 241 ALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTL 300
             G + + S G  +     L+K      +  + + ++GK  + +    G     N L+  
Sbjct: 262 NAGCR-VLSVG-YQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAA 319

Query: 301 GIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVL 360
           G+   +  D    ++ L   H   GR + +    ++G    +D ++ +N   M     +L
Sbjct: 320 GLCIAIGIDSALVLEHLEKLHVVPGRFE-FVGTNSRGGRIYVDYAHTSNSLEM-----IL 373

Query: 361 SQISPHGEGRRIAVLG 376
             I     GR I V G
Sbjct: 374 KNIRTITSGRIIVVFG 389

>gi|254781096|ref|YP_003065509.1| UDP-N-acetylmuramate--L-alanine ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 474 Back     alignment
 Score = 42.4 bits (98), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 145/367 (39%), Gaps = 39/367 (10%)

Query: 100 VAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACI-GSYNNHIGVPLTLARMPV 158
           +A  +R + +I +++G+ GKTTT  ++   L   K     I G   N  G   T AR+  
Sbjct: 100 LAGLMRCRKSI-SVSGTHGKTTTTSLIAALLEQGKFDPTVINGGIINSYG---TNARIGT 155

Query: 159 DVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLE 218
             ++ + E   S    IR  + +V     V+T I P HL  +     I +A  +  + + 
Sbjct: 156 S-EWIVVEADESDGTFIRLPSDIV-----VVTNIDPEHLDYYGDFNAIRAAFYKFIDNIP 209

Query: 219 KTGTIFLNYDDSFFELLKAKSHALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQG 278
             G   +  D      L A+   +  + I ++G+   AD +    ++ S +S  +V +QG
Sbjct: 210 FYGFAVVCMDHPEVRSLIAR---IQNRKIITYGRHPQADIRYSNIRKYSGRSIFDVSVQG 266

Query: 279 ---KSMEVVHH----GIGYHMAQNMLMTLGIVSILTADVDTAIKALSVFHPKEGRGKRYR 331
              K + V+       IG H   N   ++ +   L    +   K L+ F    G  +R+ 
Sbjct: 267 NVTKDLTVIKDLSLPLIGEHNISNACASIAVAYKLGLSSEDVKKGLASF---SGIKRRFT 323

Query: 332 CALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSF--- 388
                    + D+ Y  +P  + + ++ + QI P    R+I  +        LS  F   
Sbjct: 324 LVGVWNDVHVFDD-YGHHPIEISSVLAAVRQICP----RKIIAIHQPHRYSRLSTLFDQF 378

Query: 389 -----HIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIH--VHYSETMDGLFLFIQSSL 441
                  D+  +  +Y+     + GF    L   +    H   +Y ++ D L   I +  
Sbjct: 379 SSCFGDADIVLISPVYSAGEKEIPGFSSPELVKNIKLQGHPQAYYMDSFDHLVSKILAIA 438

Query: 442 VDGDVVV 448
             GD ++
Sbjct: 439 EPGDFII 445

>gi|254780858|ref|YP_003065271.1| NADH dehydrogenase I subunit F [Candidatus Liberibacter asiaticus str. psy62] Length = 425 Back     alignment
 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 275 QLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDT----AIKALSVFHPKEGRGKRY 330
           Q++G  M+       Y   + M   LG  +++  D  T    AI  LSVF+  E  G+  
Sbjct: 297 QMRGAIMD-------YDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCT 349

Query: 331 RCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGD 377
            C    G+   + E      A  K  I +L ++S + EGR I  LGD
Sbjct: 350 PCREGTGWMMRVMERLVKGIAQ-KREIDLLYEVSKNIEGRTICALGD 395

>gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Back     alignment
 Score = 32.3 bits (72), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 9/125 (7%)

Query: 90  DVLGALNKLAVAARLRS-KATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIG 148
           +++G +       R  S ++  IA+TG+ GK++T  +++  L   K  Y        +IG
Sbjct: 94  EIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR--KNGYDV--QLGGNIG 149

Query: 149 VPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIAS 208
           +P+          F + E     +     LT  + P I V+  I+P HL     +E   +
Sbjct: 150 LPILNLEYFSPNRFYVIECSSYQIE----LTPTIDPSIGVLLNISPDHLDRHHTLENYVN 205

Query: 209 AKAEI 213
            K +I
Sbjct: 206 IKKKI 210

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
315122415472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel 1 0.0
209550178477 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel 1 1e-138
116253052477 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine lig 1 1e-136
241205561477 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel 1 1e-135
222086448486 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L- lysyl- D -a 1 1e-132
327194626479 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -ala 1 1e-132
190892587470 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -ala 1 1e-128
86358454470 UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -ala 1 1e-127
325293469477 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel 1 1e-127
222149140477 UDP-MurNAc-pentapeptide synthetase [Agrobacterium vitis 1 1e-123
>gi|315122415|ref|YP_004062904.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 472 Back     alignment and organism information
 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/472 (75%), Positives = 408/472 (86%)

Query: 1   MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHA 60
           M+ LWTFHDLL AIQG ++G VP+ FV GISIDSRSIAP+EAFFAIKG HYDGHDF+LHA
Sbjct: 1   MSNLWTFHDLLHAIQGKALGEVPEDFVQGISIDSRSIAPKEAFFAIKGDHYDGHDFVLHA 60

Query: 61  VQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKT 120
           VQK A LVV+N +M+ASIG LS+PVF V+DVL ALNKLA AARLRS+A IIAITGSVGKT
Sbjct: 61  VQKSACLVVINAEMMASIGPLSVPVFVVEDVLSALNKLASAARLRSQAKIIAITGSVGKT 120

Query: 121 TTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTH 180
           T KEML +ALSS  K +  I SYNNHIGVPLTLA+MP D +FGIFELGMSHLGEIRFLTH
Sbjct: 121 TAKEMLKLALSSAGKIHVSIASYNNHIGVPLTLAQMPADAEFGIFELGMSHLGEIRFLTH 180

Query: 181 LVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSH 240
           LVRPHIA+ITTIAPAHL NFSGIEEIASAK+EIFEGLEKTGT+ LN DDSFFE LK KSH
Sbjct: 181 LVRPHIAMITTIAPAHLGNFSGIEEIASAKSEIFEGLEKTGTVLLNRDDSFFEFLKEKSH 240

Query: 241 ALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTL 300
            LGI  +Y+FG+S +ADF+L   +QCSE+S M VQLQGKS EVVHH +G HMAQN+L TL
Sbjct: 241 LLGIYNVYTFGESIDADFRLLTLEQCSEESRMRVQLQGKSAEVVHHAVGRHMAQNILATL 300

Query: 301 GIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVL 360
           GIVS+L A ++ AI+ +S+F+P++GRGKRYRCAL +GFFTLIDESYNANP SM+AAISVL
Sbjct: 301 GIVSLLDASIEKAIQDISLFYPQKGRGKRYRCALKEGFFTLIDESYNANPTSMRAAISVL 360

Query: 361 SQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPR 420
           SQISPHG+GRRIAVLGDM EMGE ++SFHIDLAE+L  YNISHVWLSG HVLALK+ALP+
Sbjct: 361 SQISPHGKGRRIAVLGDMSEMGERAESFHIDLAEILCSYNISHVWLSGVHVLALKNALPK 420

Query: 421 SIHVHYSETMDGLFLFIQSSLVDGDVVVVKSSNSCGFYRLINLLLEEFPAIQ 472
            +HVHY E +D   LFIQSSL+DGDV+V+KSS+SCGF+ L+ LLLEEF  IQ
Sbjct: 421 DMHVHYRERIDDFLLFIQSSLIDGDVIVIKSSHSCGFHSLVELLLEEFTLIQ 472


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550178|ref|YP_002282095.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 477 Back     alignment and organism information
>gi|116253052|ref|YP_768890.1| UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [Rhizobium leguminosarum bv. viciae 3841] Length = 477 Back     alignment and organism information
>gi|241205561|ref|YP_002976657.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 477 Back     alignment and organism information
>gi|222086448|ref|YP_002544982.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L- lysyl- D -alanyl-D-alanine synthetase protein [Agrobacterium radiobacter K84] Length = 486 Back     alignment and organism information
>gi|327194626|gb|EGE61476.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -alanyl-D-alanine synthetase protein [Rhizobium etli CNPAF512] Length = 479 Back     alignment and organism information
>gi|190892587|ref|YP_001979129.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -alanyl-D-alanine synthetase [Rhizobium etli CIAT 652] Length = 470 Back     alignment and organism information
>gi|86358454|ref|YP_470346.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-D -alanyl-D-alanine synthetase protein [Rhizobium etli CFN 42] Length = 470 Back     alignment and organism information
>gi|325293469|ref|YP_004279333.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanine ligase [Agrobacterium sp. H13-3] Length = 477 Back     alignment and organism information
>gi|222149140|ref|YP_002550097.1| UDP-MurNAc-pentapeptide synthetase [Agrobacterium vitis S4] Length = 477 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
PRK14093479 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutam 1e-123
TIGR01143417 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-ala 5e-98
PRK11929958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 1e-79
PRK11930 822 PRK11930, PRK11930, putative bifunctional UDP-N-acetylm 6e-46
COG0770451 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthas 1e-105
PRK10773453 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alan 9e-56
PRK11929 958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 1e-28
COG0769475 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase 2e-25
TIGR01085464 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthet 2e-23
PRK00139460 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate- 3e-23
pfam08245188 pfam08245, Mur_ligase_M, Mur ligase middle domain 1e-36
PRK02472447 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 5e-10
PRK14573 809 PRK14573, PRK14573, bifunctional D-alanyl-alanine synth 9e-08
COG0773459 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cel 2e-24
PRK00421461 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; 4e-16
COG0771448 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate 1e-20
TIGR01087433 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutama 9e-19
TIGR01082448 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase 1e-17
PRK14106450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-11
PRK01438480 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-09
PRK02006498 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-06
pfam0122576 pfam01225, Mur_ligase, Mur ligase family, catalytic dom 4e-09
PRK14022481 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutam 3e-08
PRK01710458 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 5e-08
PRK01368454 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-06
PRK01390460 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 8e-05
PRK03815401 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 0.001
PRK04308445 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 5e-07
PRK03803448 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 7e-06
PRK04663438 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-04
PRK03806438 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-04
pfam0287587 pfam02875, Mur_ligase_C, Mur ligase family, glutamate l 1e-05
COG0285427 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme me 0.001
PRK04690468 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 0.003
>gnl|CDD|184501 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162224 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|183386 PRK11930, PRK11930, putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162196 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthetase Back     alignment and domain information
>gnl|CDD|178894 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional Back     alignment and domain information
>gnl|CDD|149357 pfam08245, Mur_ligase_M, Mur ligase middle domain Back     alignment and domain information
>gnl|CDD|179428 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31116 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179018 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31114 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162197 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>gnl|CDD|162195 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179297 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|144716 pfam01225, Mur_ligase, Mur ligase family, catalytic domain Back     alignment and domain information
>gnl|CDD|184459 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional Back     alignment and domain information
>gnl|CDD|179323 PRK01710, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179286 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179291 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179652 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|167786 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179650 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179651 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|145824 pfam02875, Mur_ligase_C, Mur ligase family, glutamate ligase domain Back     alignment and domain information
>gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|179872 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
TIGR01143462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11929953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 100.0
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 100.0
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 100.0
TIGR01081459 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso 100.0
PRK10773452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 100.0
COG0770451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 100.0
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 100.0
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 100.0
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 100.0
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0773459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 100.0
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 100.0
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 100.0
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0285427 FolC Folylpolyglutamate synthase [Coenzyme metabolism] 100.0
PRK10846416 bifunctional folylpolyglutamate synthase/ dihydrofolate 100.0
). A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01499">TIGR01499460 folC FolC bifunctional protein; InterPro: IPR001645 Fol 100.0
KOG2525496 consensus 99.89
pfam08245188 Mur_ligase_M Mur ligase middle domain. 100.0
pfam0122576 Mur_ligase Mur ligase family, catalytic domain. This fa 99.71
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 98.15
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 96.96
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 96.04
pfam0461372 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 95.06
pfam07085105 DRTGG DRTGG domain. This presumed domain is about 120 a 94.34
COG4109432 Predicted transcriptional regulator containing CBS doma 90.97
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 90.96
pfam0287587 Mur_ligase_C Mur ligase family, glutamate ligase domain 99.0
PRK05439312 pantothenate kinase; Provisional 95.26
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 91.6
PRK13869405 plasmid-partitioning protein RepA; Provisional 91.09
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 90.42
PRK00409 780 recombination and DNA strand exchange inhibitor protein 93.14
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 92.83
TIGR01069834 mutS2 MutS2 family protein; InterPro: IPR005747 Mismatc 92.27
TIGR00670336 asp_carb_tr aspartate carbamoyltransferase; InterPro: I 92.04
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 90.04
TIGR02764198 spore_ybaN_pdaB polysaccharide deacetylase family sporu 91.38
TIGR01278 562 DPOR_BchB light-independent protochlorophyllide reducta 91.32
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 91.22
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 90.28
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 90.16
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757 The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>COG0770 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional Back     alignment and domain information
>TIGR01499 folC FolC bifunctional protein; InterPro: IPR001645 Folylpolyglutamate synthase 6 Back     alignment and domain information
>KOG2525 consensus Back     alignment and domain information
>pfam08245 Mur_ligase_M Mur ligase middle domain Back     alignment and domain information
>pfam01225 Mur_ligase Mur ligase family, catalytic domain Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>pfam04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD Back     alignment and domain information
>pfam07085 DRTGG DRTGG domain Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein; InterPro: IPR005747 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase; InterPro: IPR002082 Aspartate carbamoyltransferase (ATCase) catalyses the formation of carbamoyl-aspartate in the pyrimidine biosynthesis pathway, by the association of aspartate and carbamoyl-phosphate Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB; InterPro: IPR014132 This entry describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria Back     alignment and domain information
>TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit; InterPro: IPR005969 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
1gg4_A452 Crystal Structure Of Escherichia Coli Udpmurnac-Tri 7e-64
2am1_A454 Sp Protein Ligand 1 Length = 454 4e-56
1e8c_A498 Structure Of Mure The Udp-N-Acetylmuramyl Tripeptid 1e-24
2wtz_A535 Mure Ligase Of Mycobacterium Tuberculosis Length = 2e-21
1gqq_A475 Murc - Crystal Structure Of The Apo-Enzyme From Hae 1e-08
1p31_A475 Crystal Structure Of Udp-N-Acetylmuramic Acid:l-Ala 3e-06
3lk7_A451 The Crystal Structure Of Udp-N-Acetylmuramoylalanin 1e-05
1e0d_A437 Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase L 1e-07
2jff_A445 Crystal Structure Of Murd Ligase In Complex With D- 1e-07
2uag_A437 Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase L 1e-07
2wjp_A439 Crystal Structure Of Murd Ligase In Complex With D- 1e-07
>gi|12084404|pdb|1GG4|A Chain A, Crystal Structure Of Escherichia Coli Udpmurnac-Tripeptide D-Alanyl-D-Alanine-Adding Enzyme (Murf) At 2.3 Angstrom Resolution Length = 452 Back     alignment and structure
 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 132/463 (28%), Positives = 206/463 (44%), Gaps = 21/463 (4%)

Query: 6   TFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGA 65
           T   L   + G   G      ++ ++ D+R + P   F A+KG  +D HDF   A   GA
Sbjct: 5   TLSQLTDILNGELQG--ADITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAGGA 62

Query: 66  GLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEM 125
           G ++V+  +      + +P   V D   A  +LA   R +  A ++A+TGS GKT+ KE 
Sbjct: 63  GALLVSRPL-----DIDLPQLIVKDTRLAFGELAAWVRQQVPARVVALTGSSGKTSVKEX 117

Query: 126 LTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPH 185
               LS    T    G+ NN IGVP TL R+  + D+ + ELG +H GEI +   L RP 
Sbjct: 118 TAAILSQCGNTLYTAGNLNNDIGVPXTLLRLTPEYDYAVIELGANHQGEIAWTVSLTRPE 177

Query: 186 IAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIK 245
            A++  +A AHL  F  +  +A AK EIF GL + G    N D++ +   ++   +  + 
Sbjct: 178 AALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIXNADNNDWLNWQSVIGSRKVW 237

Query: 246 TIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSI 305
                  + N+DF        S  +   +Q    S++V+    G H   N L    +   
Sbjct: 238 R--FSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRHNIANALAAAALSXS 295

Query: 306 LTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISP 365
           + A +D     L+      GR    + A N     L+D+SYNAN  S  AA+ VL+    
Sbjct: 296 VGATLDAIKAGLANLKAVPGRLFPIQLAEN---QLLLDDSYNANVGSXTAAVQVLA---- 348

Query: 366 HGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPRSIHVH 425
              G R+ V+GD  E+G  S++ H+ + E      I  V   G    A+  A   S    
Sbjct: 349 EXPGYRVLVVGDXAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAISTA---SGVGE 405

Query: 426 YSETMDGLFLFIQSSLVDGDV--VVVKSSNSCGFYRLINLLLE 466
           +      L   ++  + +  V  ++VK S S     ++  L E
Sbjct: 406 HFADKTALITRLKLLIAEQQVITILVKGSRSAAXEEVVRALQE 448


>gi|88192084|pdb|2AM1|A Chain A, Sp Protein Ligand 1 Length = 454 Back     alignment and structure
>gi|15988379|pdb|1E8C|A Chain A, Structure Of Mure The Udp-N-Acetylmuramyl Tripeptide Synthetase From E. Coli Length = 498 Back     alignment and structure
>gi|281306936|pdb|2WTZ|A Chain A, Mure Ligase Of Mycobacterium Tuberculosis Length = 535 Back     alignment and structure
gi|33356936|pdb|1GQQ|A Chain A, Murc - Crystal Structure Of The Apo-Enzyme From Haemophilus Influenzae Length = 475 Back     alignment and structure
>gi|34811495|pdb|1P31|A Chain A, Crystal Structure Of Udp-N-Acetylmuramic Acid:l-Alanine Ligase (Murc) From Haemophilus Influenzae Length = 475 Back     alignment and structure
>gi|288563201|pdb|3LK7|A Chain A, The Crystal Structure Of Udp-N-Acetylmuramoylalanine-D- Glutamate (Murd) Ligase From Streptococcus Agalactiae To 1.5a Length = 451 Back     alignment and structure
>gi|9257128|pdb|1E0D|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase Length = 437 Back     alignment and structure
>gi|149242346|pdb|2JFF|A Chain A, Crystal Structure Of Murd Ligase In Complex With D-Glu Containing Sulfonamide Inhibitor Length = 445 Back     alignment and structure
>gi|7245651|pdb|2UAG|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase Length = 437 Back     alignment and structure
>gi|304445552|pdb|2WJP|A Chain A, Crystal Structure Of Murd Ligase In Complex With D-Glu Containing Rhodanine Inhibitor Length = 439 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 3e-71
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 1e-60
2am1_A454 SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysi 3e-47
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 2e-46
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 6e-32
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, str 9e-22
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond liga 1e-19
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 6e-18
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 1e-20
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 4e-17
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 7e-07
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 9e-05
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-di 1e-06
>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 452 Back     alignment and structure
 Score =  264 bits (675), Expect = 3e-71
 Identities = 133/470 (28%), Positives = 211/470 (44%), Gaps = 22/470 (4%)

Query: 1   MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHA 60
           M  + T   L   + G   G      ++ ++ D+R + P   F A+KG  +D HDF   A
Sbjct: 1   MISV-TLSQLTDILNGELQG--ADITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQA 57

Query: 61  VQKGAGLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKT 120
              GAG ++V+  +      + +P   V D   A  +LA   R +  A ++A+TGS GKT
Sbjct: 58  KAGGAGALLVSRPL-----DIDLPQLIVKDTRLAFGELAAWVRQQVPARVVALTGSSGKT 112

Query: 121 TTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTH 180
           + KEM    LS    T    G+ NN IGVP+TL R+  + D+ + ELG +H GEI +   
Sbjct: 113 SVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANHQGEIAWTVS 172

Query: 181 LVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSH 240
           L RP  A++  +A AHL  F  +  +A AK EIF GL + G   +N D++ +   ++   
Sbjct: 173 LTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNNDWLNWQSVIG 232

Query: 241 ALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTL 300
           +  +        + N+DF        S  +   +Q    S++V+    G H   N L   
Sbjct: 233 SRKVWRFSPN--AANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRHNIANALAAA 290

Query: 301 GIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVL 360
            +   + A +D     L+      GR    +         L+D+SYNAN  SM AA+ VL
Sbjct: 291 ALSMSVGATLDAIKAGLANLKAVPGRLFPIQ---LAENQLLLDDSYNANVGSMTAAVQVL 347

Query: 361 SQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHVWLSGFHVLALKDALPR 420
           +++     G R+ V+GDM E+G  S++ H+ + E      I  V   G    A+  A   
Sbjct: 348 AEMP----GYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAISTASGV 403

Query: 421 SIHVHYSETMDGLFLFIQSSLVDGDVVVV--KSSNSCGFYRLINLLLEEF 468
             H         L   ++  + +  V+ +  K S S     ++  L E  
Sbjct: 404 GEHF---ADKTALITRLKLLIAEQQVITILVKGSRSAAMEEVVRALQENG 450


>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.0A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 498 Back     alignment and structure
>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D- alanyl-D-alanine ligase, MURF protein...; HET: 1LG; 2.50A {Streptococcus pneumoniae R6} PDB: 2am2_A* Length = 454 Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Length = 535 Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Length = 475 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Length = 524 Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Length = 491 Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Length = 469 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Length = 428 Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Length = 437 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-diaminopimelate ligase; structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis MC58} Length = 326 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimel
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 100.0
2am1_A454 SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysi 100.0
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 100.0
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 100.0
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 100.0
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 100.0
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 100.0
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 100.0
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond liga 100.0
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, str 100.0
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, confo 100.0
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 100.0
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 100.0
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 100.0
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 100.0
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-di 100.0
3mvn_A163 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diami 99.54
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 97.8
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 97.34
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2.50A { 94.65
3c8u_A208 Fructokinase; YP_612366.1, putative fructose transport 92.66
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural genomi 92.29
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleotide-bi 91.11
3end_A307 Light-independent protochlorophyllide reductase iron-su 90.78
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iron-sul 90.24
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, UW, 90.1
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-ligase, 90.06
2ioj_A139 Hypothetical protein AF_1212; NYSGXRC, PFAM:DRTGG, stru 90.4
>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=713.66  Aligned_cols=447  Identities=30%  Similarity=0.439  Sum_probs=411.4

Q ss_pred             CCCCCCHHHHHHHHCCEEECCCCCCEEEEEEEECCCCCCCCEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCC
Q ss_conf             95435678899872799952688714746774022237898889716887476888999998698899985521245544
Q gi|254781101|r    1 MNPLWTFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNTDMVASIGS   80 (472)
Q Consensus         1 m~~~~~~~~l~~~~~g~~~~~~~~~~i~~i~~dSr~v~~g~lFval~g~~~DGh~~i~~A~~~Ga~~~i~~~~~~~~~~~   80 (472)
                      |..| +|++|+++++|++.+.  |..|+++++|||+|+||++|||++|.++|||+|+++|+++||+++|++++.     +
T Consensus         1 m~~~-~l~~l~~~l~~~l~~~--d~~i~~is~DSr~v~~g~lFval~G~~~dG~~fi~~A~~~GA~~ii~~~~~-----~   72 (452)
T 1gg4_A            1 MISV-TLSQLTDILNGELQGA--DITLDAVTTDTRKLTPGCLFVALKGERFDAHDFADQAKAGGAGALLVSRPL-----D   72 (452)
T ss_dssp             CCCE-EHHHHHHHTTEEEESC--CCEESCEESCGGGCCTTCEEECCBCSSCBTTTTHHHHHHTTCCEEEESSCC-----S
T ss_pred             CCCC-CHHHHHHHHCCEEECC--CCCEEEEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCC-----C
T ss_conf             9777-5999999769998789--825727995478079997899935787788999999998699599986876-----7


Q ss_pred             CCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCCHHCCCCCCC
Q ss_conf             69728995998999999999998306993999830365420123346777752011222122110145741000123221
Q gi|254781101|r   81 LSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDV  160 (472)
Q Consensus        81 ~~~~~i~v~d~~~al~~la~~~~~~~~~~vI~ITGTnGKTTt~~~l~~iL~~~~~~~~t~gn~Nn~iGvpltll~~~~~~  160 (472)
                      .++|+|.|+|++++|..||+++|.+++.++||||||||||||++|++++|+..|.++++.||+|+++|+|++++.+.+++
T Consensus        73 ~~~p~i~v~d~~~al~~la~~~~~~~~~~vi~ITGT~GKTTt~~~l~~il~~~g~~~~~~~~~~~~ig~~~~~~~~~~~~  152 (452)
T 1gg4_A           73 IDLPQLIVKDTRLAFGELAAWVRQQVPARVVALTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEY  152 (452)
T ss_dssp             CSSCEEEESCHHHHHHHHHHHHHHHSCCEEEEEECSSCHHHHHHHHHHHHTTTSCEEECCTTCCSTTHHHHHHTTCCTTC
T ss_pred             CCCCEEEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHCCCCC
T ss_conf             99999998988999999999987079924699971367404456788777765214302357788737546664302555


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCHHHHHHHHHCC
Q ss_conf             44430156644332112122323220255531210123444578888654331037622101210134246899875201
Q gi|254781101|r  161 DFGIFELGMSHLGEIRFLTHLVRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSH  240 (472)
Q Consensus       161 ~~~V~E~g~~~~gei~~L~~i~~P~iaiiTNI~~dHld~~~s~e~i~~~K~~i~~~l~~~g~~ViN~Dd~~~~~l~~~~~  240 (472)
                      +++|+|+|++++|++.+++..++|+++|||||++||||+|+|+|+|+++|++||+++++++.+|+|.||+.+..+.....
T Consensus       153 ~~~v~E~~~~~~~~~~~~~~~~~pdiaviTNI~~dHld~~~s~e~y~~aK~~lf~~l~~~~~~i~n~Dd~~~~~~~~~~~  232 (452)
T 1gg4_A          153 DYAVIELGANHQGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNNDWLNWQSVIG  232 (452)
T ss_dssp             SEEEEECCCSSSSHHHHHHHHHCCSEEEECCCC--------CHHHHHHHHHGGGGGCCTTCEEEEETTBCCHHHHHHHHT
T ss_pred             CEEEEEECCCCCHHHHHHHCCCCCCEEEEEEECHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHH
T ss_conf             72899952886606776624568878999544055415656289999999999854442576323678768889988750


Q ss_pred             CCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHC
Q ss_conf             2333332222222-222222344211346510012456543221222222223333221035676510121034554311
Q gi|254781101|r  241 ALGIKTIYSFGKS-KNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDTAIKALSV  319 (472)
Q Consensus       241 ~~~~~~i~~~g~~-~~ad~~~~~i~~~~~~~~~~~~~~~~~~~~~l~~~G~hnv~NalaAia~~~~lGi~~~~i~~~L~~  319 (472)
                      .   ..+++|+.. +++|+++.++....++..|.+..+++.+++.++++|+||++|+++|++++..+|++.++|.++|.+
T Consensus       233 ~---~~~~~~~~~~~~~d~~~~~~~~~~~~~~f~l~~~~~~~~~~~~l~G~hnv~NalaAia~~~~lg~~~~~i~~~l~~  309 (452)
T 1gg4_A          233 S---RKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRHNIANALAAAALSMSVGATLDAIKAGLAN  309 (452)
T ss_dssp             T---SEEEEECSSCTTCSBEEEEEEECSSSEEEEEEETTEEEEEEECSSSTHHHHHHHHHHHHHHHTTCCHHHHHHHHTT
T ss_pred             C---CCCEEECCCCCCCCEEEEEEEECCCCCEEEEEECCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             4---6631544666577567774377079718999954614899972577321140899986665549989999999874


Q ss_pred             CCCCCCCCCCCEECCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCHHHCCCCHHHHHHHHHHHHHHC
Q ss_conf             47664433101000365311331000256532101257778741110268713885123541710589999999999864
Q gi|254781101|r  320 FHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLY  399 (472)
Q Consensus       320 ~~~~~GR~~~~~~~~~~~~~~iIDDsYNAnP~S~~aal~~l~~~~~~~~~r~i~VlG~m~ELG~~~~~~h~~i~~~~~~~  399 (472)
                      |++++||++...   ..++.++|||+||+||+||+++|+++++++    +||++|+|+|.|+|+++...|+++++.+.+.
T Consensus       310 ~~~v~~R~~~~~---~~~~~~~idD~y~~np~s~~a~l~~l~~~~----~~ki~i~g~~~elG~~~~~~~~~i~~~~~~~  382 (452)
T 1gg4_A          310 LKAVPGRLFPIQ---LAENQLLLDDSYNANVGSMTAAVQVLAEMP----GYRVLVVGDMAELGAESEACHVQVGEAAKAA  382 (452)
T ss_dssp             CCCCTTSSEEEE---EETTEEEEECCSCCCHHHHHHHHHHHHHSS----SEEEEEECCCCCCTTHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHEEEE---ECCCCEEEEECCCCCHHHHHHHHHHHHHCC----CCEEEEEEECCCCCCHHHHHHHHHHHHHHHC
T ss_conf             459983115898---428957998247689799999999998668----9839999976878864799999999999857


Q ss_pred             CCCEEEEECCCHHHHHHHCCCCCCEEEECCHHHHHHHHHHHCCCCC--EEEEECCCHHHHHHHHHHHHHHC
Q ss_conf             9989999880389899851137979997898999999998447898--99997713254899999999850
Q gi|254781101|r  400 NISHVWLSGFHVLALKDALPRSIHVHYSETMDGLFLFIQSSLVDGD--VVVVKSSNSCGFYRLINLLLEEF  468 (472)
Q Consensus       400 ~~d~v~~~G~~~~~~~~~~~~~~~~~~~~~~e~a~~~l~~~~~~gd--iVLiKGSr~~~le~iv~~L~~~~  468 (472)
                      ++|.|+++|+..+.+.+...   ...++++.++++..+.+.+.++|  +||+||||+++||+++++|+|.+
T Consensus       383 ~~d~vi~~G~~~~~i~~~~~---~~~~~~~~~~~i~~l~~~~~~~d~~~iL~KGSr~~~le~~v~~L~~~~  450 (452)
T 1gg4_A          383 GIDRVLSVGKQSHAISTASG---VGEHFADKTALITRLKLLIAEQQVITILVKGSRSAAMEEVVRALQENG  450 (452)
T ss_dssp             TCSEEEEESSSTHHHHHHTT---SCEEESSHHHHHHHHHHHHHHCSSEEEEEECCGGGTTHHHHHHHC---
T ss_pred             CCCEEEEECCCHHHHHHHCC---CCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             99999997828899986478---870638999999999985336995699991418515999999998628



>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D- alanyl-D-alanine ligase, MURF protein...; HET: 1LG; 2.50A {Streptococcus pneumoniae R6} PDB: 2am2_A* Back     alignment and structure
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, conformational change, peptidoglycan synthesis, cell division, cobalt binding; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthase; TM0166, structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-diaminopimelate ligase; structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3mvn_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diaminopimelate ligase; structural genomics, MCSG, PSI-2; 1.90A {Haemophilus ducreyi} Back     alignment and structure