254781102

254781102

UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase

GeneID in NCBI database:8210127Locus tag:CLIBASIA_05020
Protein GI in NCBI database:254781102Protein Accession:YP_003065515.1
Gene range:-(1101593, 1103086)Protein Length:497aa
Gene description:UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase
COG prediction:[M] UDP-N-acetylmuramyl tripeptide synthase
KEGG prediction:murE; UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13); K01928 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
SEED prediction:UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)
Pathway involved in KEGG:Lysine biosynthesis [PATH:las00300]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
ccHHHHHHHHHHHHHHHHccccccccccEEEEEEEEccccccccEEEEEcccccccHHHHHHHHHccccEEEEccccccccccccHHccccEEEEcHHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHcccccccEEEEccccHHHHHHcccHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccEEcccEEccccEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEcccccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHcccccEEEEEEcccccccEEcccccccccHHHHHHHHHHHcc
ccHHHHHcccHHHHHHHcccccccccccEEEEEEEcccEcccccEEEEEEccEcccHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccEEEEEEccHHHHccccccccEEEEEEEccccccHcccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHcccccEEEEEcccccccEEEEEEEEccccEEEEEEEccccEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEccccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHcccccEEEccHHHHHHHHHHHcccccEEEEEcccccccEEEcccEEEcccHHHHHHHHHHHHc
MKLQDLIYKDFPELINQLSIFPMQWRERKinevssdsrhiQAGWIFVAIVgnkedghlfiPQAIAQGAEAIVVSSAyslqdfsatirsntpilvvDNTRKFLSLFASRlygkhpenilavtgtsgkSSVASFVQQICqrsglssfqigptstissfaqdnrlttpspIYLAKALSYLSSQGVTHVSVEasshgldqhRLDGIKLIAGsftnlgrdhidyHQTQQAYFNAKMRLFEellpkespaiiyaddAYSKEVMKRAHNAGcrvlsvgyqgkfihLKKVCAIHNKQQVTisvegkdfdflfplpgefQVYNALVAAGLCIAIGIDSALVLEHLEKLhvvpgrfefvgtnsrggriyvdyahtsNSLEMILKNIRTITSGRIIVVFgcggdrdqgkrpimgkialdladiaivtddnprsedpeKIRAEIIHgipgfiekgNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTngekkmsvDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDfsatirsntpilvvDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGrfefvgtnsrggrIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGcggdrdqgkrPIMGKIALDLADIAIVtddnprsedpeKIRAEiihgipgfiekgNRIEAIRTAIEMLNKQDVLVVAGKGHETVhivtngekkmsvdcDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSAlvlehleklhvvPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL
MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLIL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
254781101472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diamino 4e-09
254781099468 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 0.003
254780821429 FolC bifunctional protein [Candidatus Liberibacter 0.024
>gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Back     alignment
 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 153/376 (40%), Gaps = 42/376 (11%)

Query: 30  INEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRS- 88
           +N +S DSR I     F AI G   DGH FI  A+ +GA  +VV++     D  A+I S 
Sbjct: 27  VNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVNT-----DMVASIGSL 81

Query: 89  NTPILVVDNTRKFLSLFASRLYGKHPENILAVTGTSGKSSVASFVQQICQRSGLSSFQIG 148
           + P+  VD+    L+  A     +    I+A+TG+ GK++    +        LSS +  
Sbjct: 82  SIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEMLT-----IALSSIK-K 135

Query: 149 PTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIA-- 206
             + I S+  +N +    P+ LA+            V V+     L    L  I+ +   
Sbjct: 136 TYACIGSY--NNHIGV--PLTLAR----------MPVDVDFGIFELGMSHLGEIRFLTHL 181

Query: 207 -----GSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAH 261
                   T +   H+      +   +AK  +FE  L K     +  DD++ + +  ++H
Sbjct: 182 VRPHIAVITTIAPAHLSNFSGIEEIASAKAEIFEG-LEKTGTIFLNYDDSFFELLKAKSH 240

Query: 262 NAGCR-VLSVG-YQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAA 319
             G + + S G  +     L+K      +  + + ++GK  + +    G     N L+  
Sbjct: 241 ALGIKTIYSFGKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHGIGYHMAQNMLMTL 300

Query: 320 GLCIAIGIDSALVLEHLEKLHVVPGRFE-FVGTNSRGGRIYVDYAHTSNSLEM-----IL 373
           G+   +  D    ++ L   H   GR + +    ++G    +D ++ +N   M     +L
Sbjct: 301 GIVSILTADVDTAIKALSVFHPKEGRGKRYRCALNQGFFTLIDESYNANPASMKAAISVL 360

Query: 374 KNIRTITSGRIIVVFG 389
             I     GR I V G
Sbjct: 361 SQISPHGEGRRIAVLG 376

>gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 468 Back     alignment
 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 31/121 (25%)

Query: 118 LAVTGTSGKSSVASFVQQICQRSGLSSFQIG-----PTSTISSFAQDNRLTTPSPIYLAK 172
           +AVTGT+GKSS  + +  + +++G    Q+G     P   +  F       +P+  Y+ +
Sbjct: 116 IAVTGTNGKSSTVALISHVLRKNGY-DVQLGGNIGLPILNLEYF-------SPNRFYVIE 167

Query: 173 ALSYLSSQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMR 232
             SY          +E +           I    G   N+  DH+D H T + Y N K +
Sbjct: 168 CSSY---------QIELTP---------TIDPSIGVLLNISPDHLDRHHTLENYVNIKKK 209

Query: 233 L 233
           +
Sbjct: 210 I 210

>gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Back     alignment
 Score = 32.0 bits (71), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 117 ILAVTGTSGKSSVASFVQQICQRSGLS 143
           ++ + GT+GK SVASF Q++ + SGLS
Sbjct: 26  VIHIGGTNGKGSVASFSQRLLETSGLS 52

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
315122414500 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 0.0
227822656486 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 1e-125
86358455506 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 1e-125
222086449487 UDP-N-acetylmuramoylalanyl-D-glutamate--2 [Agrobacteriu 1 1e-125
190892588506 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin opim 1 1e-124
265984473490 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopi 1 1e-124
254719467488 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 1e-124
261222578490 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopi 1 1e-124
209550179505 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 1e-124
254708108488 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime 1 1e-124
>gi|315122414|ref|YP_004062903.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 500 Back     alignment and organism information
 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/496 (76%), Positives = 441/496 (88%), Gaps = 3/496 (0%)

Query: 1   MKLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFI 60
           MKLQDLIYKDFPELINQLS FP+Q RER+I+++SSDSRHIQ GW+FVAIVGN+EDGH FI
Sbjct: 1   MKLQDLIYKDFPELINQLSRFPIQLRERRIHDISSDSRHIQVGWMFVAIVGNQEDGHFFI 60

Query: 61  PQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENILAV 120
           PQA+AQGA  IVVSS +  QDFS  ++++ PILVVDNTR+FLSL A+RLYGKHPE I AV
Sbjct: 61  PQAVAQGAGVIVVSSMHQSQDFSHVVKADIPILVVDNTRRFLSLVAARLYGKHPEKIFAV 120

Query: 121 TGTSGKSSVASFVQQICQRSGLSSFQIGPTSTISSFA-QDNRLTTPSPIYLAKALSYLSS 179
           TGTSGK+SVASFVQQI Q +GLSSFQIGP S + S   +DNRLTTPSP+Y+A+AL+YL+S
Sbjct: 121 TGTSGKTSVASFVQQISQHAGLSSFQIGPISLMPSLQREDNRLTTPSPVYIAQALAYLAS 180

Query: 180 QGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLP 239
           QG THVS+EASSHGLDQHRLDGIK IAGSFTN GRDHIDYH+TQQAYFNAKMRLFEELLP
Sbjct: 181 QGTTHVSIEASSHGLDQHRLDGIKFIAGSFTNFGRDHIDYHKTQQAYFNAKMRLFEELLP 240

Query: 240 KESPAIIYA--DDAYSKEVMKRAHNAGCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEG 297
           K SPA+I    DD++S +VM+RAHNAGCRVLSVGY+G FI LK +  I++KQQV+ISVEG
Sbjct: 241 KGSPAVICNNDDDSWSNKVMERAHNAGCRVLSVGYKGTFIRLKNLTQINDKQQVSISVEG 300

Query: 298 KDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGR 357
           KDFDFLFPL G FQV NALV+AGLCIA GID  +V+E+LEK++V+PGRFEF+G NS+GGR
Sbjct: 301 KDFDFLFPLQGAFQVSNALVSAGLCIATGIDVPVVIEYLEKVNVIPGRFEFIGNNSKGGR 360

Query: 358 IYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTD 417
           IYVDYAHT NSLEM+L+N+R ITSGRIIVVFGCGGDRD+GKR IMGKIAL+LAD++IVTD
Sbjct: 361 IYVDYAHTPNSLEMVLRNLRNITSGRIIVVFGCGGDRDRGKRKIMGKIALELADLSIVTD 420

Query: 418 DNPRSEDPEKIRAEIIHGIPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTN 477
           DNPRSE+P+ IRAEII+G PGFIE+GNR EAIR AI MLNK+DVLVVAGKGHETV I+ N
Sbjct: 421 DNPRSENPQAIRAEIINGFPGFIEEGNRQEAIRIAISMLNKEDVLVVAGKGHETVQIIHN 480

Query: 478 GEKKMSVDCDIIREIL 493
           G+ KMSVDCD+IREIL
Sbjct: 481 GKIKMSVDCDVIREIL 496


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822656|ref|YP_002826628.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Sinorhizobium fredii NGR234] Length = 486 Back     alignment and organism information
>gi|86358455|ref|YP_470347.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Rhizobium etli CFN 42] Length = 506 Back     alignment and organism information
>gi|222086449|ref|YP_002544983.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2 [Agrobacterium radiobacter K84] Length = 487 Back     alignment and organism information
>gi|190892588|ref|YP_001979130.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin opimelate ligase [Rhizobium etli CIAT 652] Length = 506 Back     alignment and organism information
>gi|265984473|ref|ZP_06097208.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase [Brucella sp. 83/13] Length = 490 Back     alignment and organism information
>gi|254719467|ref|ZP_05181278.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Brucella sp. 83/13] Length = 488 Back     alignment and organism information
>gi|261222578|ref|ZP_05936859.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase [Brucella ceti B1/94] Length = 490 Back     alignment and organism information
>gi|209550179|ref|YP_002282096.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 505 Back     alignment and organism information
>gi|254708108|ref|ZP_05169936.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Brucella pinnipedialis M163/99/10] Length = 488 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
PRK00139460 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate- 1e-141
PRK11929 958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 1e-108
PRK14022481 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutam 3e-63
TIGR01085464 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthet 1e-107
PRK04308445 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-08
COG0769475 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase 1e-105
pfam08245188 pfam08245, Mur_ligase_M, Mur ligase middle domain 1e-34
PRK02006498 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-09
PRK03806438 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-06
PRK04663438 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-05
PRK03803448 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 4e-04
COG0770451 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthas 8e-34
TIGR01143417 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-ala 5e-29
PRK11929958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 6e-24
PRK03369488 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-09
COG0771448 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate 9e-27
COG0285427 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme me 4e-18
TIGR02068864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 3e-14
TIGR01499397 TIGR01499, folC, folylpolyglutamate synthase/dihydrofol 5e-10
TIGR01087433 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutama 7e-24
PRK01390460 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-12
PRK01438480 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-12
PRK02472447 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 6e-12
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 2e-05
TIGR01081448 TIGR01081, mpl, UDP-N-acetylmuramate:L-alanyl-gamma-D-g 0.002
COG0773459 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cel 2e-23
PRK00141473 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-08
pfam0287587 pfam02875, Mur_ligase_C, Mur ligase family, glutamate l 1e-19
TIGR01082448 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase 2e-17
KOG2525496 KOG2525, KOG2525, KOG2525, Folylpolyglutamate synthase 4e-04
PRK00421461 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; 2e-14
PRK10773453 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alan 5e-14
pfam0122576 pfam01225, Mur_ligase, Mur ligase family, catalytic dom 9e-12
PRK14093479 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutam 2e-08
PRK11930 822 PRK11930, PRK11930, putative bifunctional UDP-N-acetylm 1e-12
PRK14106450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-12
PRK00683418 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-07
PRK01368454 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 1e-05
PRK04690468 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutama 3e-06
PRK10773453 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alan 7e-05
PRK14573 809 PRK14573, PRK14573, bifunctional D-alanyl-alanine synth 4e-04
>gnl|CDD|178894 PRK00139, murE, UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|184459 PRK14022, PRK14022, UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase; Provisional Back     alignment and domain information
>gnl|CDD|162196 TIGR01085, murE, UDP-N-acetylmuramyl-tripeptide synthetase Back     alignment and domain information
>gnl|CDD|167786 PRK04308, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|149357 pfam08245, Mur_ligase_M, Mur ligase middle domain Back     alignment and domain information
>gnl|CDD|179359 PRK02006, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179651 PRK03806, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179871 PRK04663, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179650 PRK03803, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162224 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|179571 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|31114 COG0771, MurD, UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|162392 TIGR01499, folC, folylpolyglutamate synthase/dihydrofolate synthase Back     alignment and domain information
>gnl|CDD|162197 TIGR01087, murD, UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>gnl|CDD|179291 PRK01390, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179297 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179428 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179461 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|130153 TIGR01081, mpl, UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso- diaminopimelate ligase Back     alignment and domain information
>gnl|CDD|31116 COG0773, MurC, UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|178896 PRK00141, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|145824 pfam02875, Mur_ligase_C, Mur ligase family, glutamate ligase domain Back     alignment and domain information
>gnl|CDD|162195 TIGR01082, murC, UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>gnl|CDD|37736 KOG2525, KOG2525, KOG2525, Folylpolyglutamate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|179018 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|144716 pfam01225, Mur_ligase, Mur ligase family, catalytic domain Back     alignment and domain information
>gnl|CDD|184501 PRK14093, PRK14093, UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|183386 PRK11930, PRK11930, putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179086 PRK00683, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179286 PRK01368, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179872 PRK04690, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 100.0
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 100.0
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 100.0
TIGR01081459 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso 100.0
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 100.0
PRK11929953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
PRK10773452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
TIGR01143462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
COG0770451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 100.0
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 100.0
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 100.0
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 100.0
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 100.0
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0773459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 100.0
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 100.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK10846416 bifunctional folylpolyglutamate synthase/ dihydrofolate 100.0
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0285427 FolC Folylpolyglutamate synthase [Coenzyme metabolism] 100.0
). A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01499">TIGR01499460 folC FolC bifunctional protein; InterPro: IPR001645 Fol 100.0
KOG2525496 consensus 99.93
pfam08245188 Mur_ligase_M Mur ligase middle domain. 100.0
pfam0287587 Mur_ligase_C Mur ligase family, glutamate ligase domain 99.88
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.83
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 93.5
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 90.8
pfam0122576 Mur_ligase Mur ligase family, catalytic domain. This fa 99.74
pfam0461372 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 94.83
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 91.52
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 90.11
PRK05439312 pantothenate kinase; Provisional 97.38
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 97.2
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 96.61
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 94.1
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 93.92
PRK09435325 arginine/ornithine transport system ATPase; Provisional 93.1
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 94.8
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 94.71
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 91.51
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 91.34
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 90.97
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 90.63
PRK13869405 plasmid-partitioning protein RepA; Provisional 90.18
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 93.4
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 92.26
PRK09841 726 cryptic autophosphorylating protein tyrosine kinase Etk 91.99
PRK00409 780 recombination and DNA strand exchange inhibitor protein 91.63
PRK09426715 methylmalonyl-CoA mutase; Reviewed 91.75
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.8
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 90.75
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757 The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>COG0770 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01499 folC FolC bifunctional protein; InterPro: IPR001645 Folylpolyglutamate synthase 6 Back     alignment and domain information
>KOG2525 consensus Back     alignment and domain information
>pfam08245 Mur_ligase_M Mur ligase middle domain Back     alignment and domain information
>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>pfam01225 Mur_ligase Mur ligase family, catalytic domain Back     alignment and domain information
>pfam04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK09435 arginine/ornithine transport system ATPase; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
1e8c_A498 Structure Of Mure The Udp-N-Acetylmuramyl Tripeptid 6e-79
2wtz_A535 Mure Ligase Of Mycobacterium Tuberculosis Length = 8e-75
2am1_A454 Sp Protein Ligand 1 Length = 454 4e-18
1gg4_A452 Crystal Structure Of Escherichia Coli Udpmurnac-Tri 3e-29
3lk7_A451 The Crystal Structure Of Udp-N-Acetylmuramoylalanin 2e-05
1o5z_A442 Crystal Structure Of Folylpolyglutamate Synthase (T 2e-04
1e0d_A437 Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase L 0.002
2jff_A445 Crystal Structure Of Murd Ligase In Complex With D- 0.002
2wjp_A439 Crystal Structure Of Murd Ligase In Complex With D- 0.002
2uag_A437 Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase L 0.002
1gqq_A475 Murc - Crystal Structure Of The Apo-Enzyme From Hae 2e-04
1j6u_A469 Crystal Structure Of Udp-N-Acetylmuramate-Alanine L 0.002
1w78_A422 E.Coli Folc In Complex With Dhpp And Adp Length = 4 0.003
>gi|15988379|pdb|1E8C|A Chain A, Structure Of Mure The Udp-N-Acetylmuramyl Tripeptide Synthetase From E. Coli Length = 498 Back     alignment and structure
 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 170/505 (33%), Positives = 246/505 (48%), Gaps = 25/505 (4%)

Query: 2   KLQDLIYKDFPELINQLSIFPMQWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIP 61
            L+DL+    P+              R + E + DSR   AG +FVA+VG++ DG  +IP
Sbjct: 4   NLRDLLAPWVPD-----------APSRALREXTLDSRVAAAGDLFVAVVGHQADGRRYIP 52

Query: 62  QAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLSLFASRLYGKHPENI--LA 119
           QAIAQG  AI+  +     D         P++ +    + LS  A R Y +  +N+  + 
Sbjct: 53  QAIAQGVAAIIAEAKDEATDGEIREXHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVG 112

Query: 120 VTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTIS-SFAQDNRLTTPSPIYLAKALSYLS 178
           VTGT+GK++    + Q  Q  G  S   G               TT S + +   L+ L 
Sbjct: 113 VTGTNGKTTTTQLLAQWSQLLGEISAVXGTVGNGLLGKVIPTENTTGSAVDVQHELAGLV 172

Query: 179 SQGVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELL 238
            QG T  + E SSHGL QHR+  +K  A  FTNL RDH+DYH   + Y  A   L+ E  
Sbjct: 173 DQGATFCAXEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDXEHYEAAXWLLYSE-- 230

Query: 239 PKESPAIIYADDAYSKEVMKRAHNAGC----RVLSVGYQGKFIHLKKVCAIHNKQQVTIS 294
                AII ADD   +  + +  +A        ++    G+++   +V    +   +  S
Sbjct: 231 HHCGQAIINADDEVGRRWLAKLPDAVAVSXEDHINPNCHGRWLKATEVNYHDSGATIRFS 290

Query: 295 VEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSR 354
               D +    L G F V N L+A    +A+G   A +L+   +L  V GR E   T   
Sbjct: 291 SSWGDGEIESHLXGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRXEVF-TAPG 349

Query: 355 GGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAI 414
              + VDYAHT ++LE  L+  R   +G++  VFGCGGDRD+GKRP+ G IA + AD+A+
Sbjct: 350 KPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLXGAIAEEFADVAV 409

Query: 415 VTDDNPRSEDPEKIRAEIIHG---IPGFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHET 471
           VTDDNPR+E+P  I  +I+ G            R EA+  A+    + DV++VAGKGHE 
Sbjct: 410 VTDDNPRTEEPRAIINDILAGXLDAGHAKVXEGRAEAVTCAVXQAKENDVVLVAGKGHED 469

Query: 472 VHIVTNGEKKMSVDCDIIREILGLI 496
             IV N       D   +  +LG+I
Sbjct: 470 YQIVGNQRLDY-SDRVTVARLLGVI 493


>gi|281306936|pdb|2WTZ|A Chain A, Mure Ligase Of Mycobacterium Tuberculosis Length = 535 Back     alignment and structure
>gi|88192084|pdb|2AM1|A Chain A, Sp Protein Ligand 1 Length = 454 Back     alignment and structure
>gi|12084404|pdb|1GG4|A Chain A, Crystal Structure Of Escherichia Coli Udpmurnac-Tripeptide D-Alanyl-D-Alanine-Adding Enzyme (Murf) At 2.3 Angstrom Resolution Length = 452 Back     alignment and structure
>gi|288563201|pdb|3LK7|A Chain A, The Crystal Structure Of Udp-N-Acetylmuramoylalanine-D- Glutamate (Murd) Ligase From Streptococcus Agalactiae To 1.5a Length = 451 Back     alignment and structure
>gi|39654293|pdb|1O5Z|A Chain A, Crystal Structure Of Folylpolyglutamate Synthase (Tm0166) From Thermotoga Maritima At 2.10 A Resolution Length = 442 Back     alignment and structure
>gi|9257128|pdb|1E0D|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase Length = 437 Back     alignment and structure
>gi|149242346|pdb|2JFF|A Chain A, Crystal Structure Of Murd Ligase In Complex With D-Glu Containing Sulfonamide Inhibitor Length = 445 Back     alignment and structure
>gi|304445552|pdb|2WJP|A Chain A, Crystal Structure Of Murd Ligase In Complex With D-Glu Containing Rhodanine Inhibitor Length = 439 Back     alignment and structure
>gi|7245651|pdb|2UAG|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase Length = 437 Back     alignment and structure
gi|33356936|pdb|1GQQ|A Chain A, Murc - Crystal Structure Of The Apo-Enzyme From Haemophilus Influenzae Length = 475 Back     alignment and structure
>gi|24987384|pdb|1J6U|A Chain A, Crystal Structure Of Udp-N-Acetylmuramate-Alanine Ligase Murc (Tm0231) From Thermotoga Maritima At 2.3 A Resolution Length = 469 Back     alignment and structure
>gi|61680167|pdb|1W78|A Chain A, E.Coli Folc In Complex With Dhpp And Adp Length = 422 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 2e-97
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 2e-82
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 2e-54
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 3e-34
2am1_A454 SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysi 6e-30
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 2e-26
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, str 6e-40
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 5e-33
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 9e-25
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond liga 1e-23
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 1e-34
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 8e-29
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 2e-28
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 5e-22
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, confo 3e-20
3mvn_A163 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diami 1e-17
2jfg_A445 UDP-N-acetylmuramoylalanine--D-glutamate ligase; nucleo 4e-10
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-di 1e-08
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.0A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 498 Back     alignment and structure
 Score =  351 bits (902), Expect = 2e-97
 Identities = 165/480 (34%), Positives = 246/480 (51%), Gaps = 14/480 (2%)

Query: 27  ERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATI 86
            R + E++ DSR   AG +FVA+VG++ DG  +IPQAIAQG  AI+  +     D     
Sbjct: 18  SRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIRE 77

Query: 87  RSNTPILVVDNTRKFLSLFASRLYGKHPENI--LAVTGTSGKSSVASFVQQICQRSGLSS 144
               P++ +    + LS  A R Y +  +N+  + VTGT+GK++    + Q  Q  G  S
Sbjct: 78  MHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEIS 137

Query: 145 FQIG-PTSTISSFAQDNRLTTPSPIYLAKALSYLSSQGVTHVSVEASSHGLDQHRLDGIK 203
             +G   + +         TT S + +   L+ L  QG T  ++E SSHGL QHR+  +K
Sbjct: 138 AVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALK 197

Query: 204 LIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRAHNA 263
             A  FTNL RDH+DYH   + Y  AK  L+         AII ADD   +  + +  +A
Sbjct: 198 FAASVFTNLSRDHLDYHGDMEHYEAAKWLLYS--EHHCGQAIINADDEVGRRWLAKLPDA 255

Query: 264 ----GCRVLSVGYQGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAA 319
                   ++    G+++   +V    +   +  S    D +    L G F V N L+A 
Sbjct: 256 VAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLAL 315

Query: 320 GLCIAIGIDSALVLEHLEKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTI 379
              +A+G   A +L+   +L  V GR E          + VDYAHT ++LE  L+  R  
Sbjct: 316 ATLLALGYPLADLLKTAARLQPVCGRMEVFTAP-GKPTVVVDYAHTPDALEKALQAARLH 374

Query: 380 TSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVTDDNPRSEDPEKIRAEIIHGIPGF 439
            +G++  VFGCGGDRD+GKRP+MG IA + AD+A+VTDDNPR+E+P  I  +I+ G+   
Sbjct: 375 CAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDA 434

Query: 440 IEK---GNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREILGLI 496
                   R EA+  A+    + DV++VAGKGHE   IV   ++    D   +  +LG+I
Sbjct: 435 GHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIV-GNQRLDYSDRVTVARLLGVI 493


>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Length = 535 Back     alignment and structure
>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 452 Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Length = 469 Back     alignment and structure
>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D- alanyl-D-alanine ligase, MURF protein...; HET: 1LG; 2.50A {Streptococcus pneumoniae R6} PDB: 2am2_A* Length = 454 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Length = 524 Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Length = 475 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Length = 491 Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Length = 437 Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Length = 428 Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthase; TM0166, structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Length = 442 Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Length = 422 Back     alignment and structure
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, conformational change, peptidoglycan synthesis, cell division, cobalt binding; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Length = 487 Back     alignment and structure
>3mvn_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diaminopimelate ligase; structural genomics, MCSG, PSI-2; 1.90A {Haemophilus ducreyi} Length = 163 Back     alignment and structure
>2jfg_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; nucleotide-binding, peptidoglycan synthesis, MURD ligase, ATP-binding, cell division, UMA, ADP; HET: KCX UMA ADP; 1.52A {Escherichia coli} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 445 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-diaminopimelate ligase; structural genomics, PSI-2, protein structure initiative; 2.55A {Neisseria meningitidis MC58} Length = 326 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopime
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 100.0
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 100.0
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 100.0
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 100.0
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 100.0
2am1_A454 SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysi 100.0
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 100.0
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, str 100.0
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, confo 100.0
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond liga 100.0
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 100.0
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 100.0
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 100.0
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 100.0
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 100.0
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-di 100.0
3mvn_A163 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diami 99.84
2xij_A762 Methylmalonyl-COA mutase, mitochondrial; isomerase, org 93.73
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 95.34
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2.50A { 93.88
3c8u_A208 Fructokinase; YP_612366.1, putative fructose transport 93.83
3aez_A312 Pantothenate kinase; transferase, homodimer, COA biosyn 93.41
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-ligase, 92.81
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural genomi 92.54
2j37_W504 Signal recognition particle 54 kDa protein (SRP54); rib 92.41
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia coli 92.28
3end_A307 Light-independent protochlorophyllide reductase iron-su 91.8
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP 90.55
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucleotide 90.42
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransfe 93.61
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr 90.75
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=745.62  Aligned_cols=469  Identities=35%  Similarity=0.509  Sum_probs=412.9

Q ss_pred             CCCCCCEEEEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCEEEECCHHHHHH
Q ss_conf             55574300245302314689889980388767688899999859889998473223334322347970999799899999
Q gi|254781102|r   24 QWRERKINEVSSDSRHIQAGWIFVAIVGNKEDGHLFIPQAIAQGAEAIVVSSAYSLQDFSATIRSNTPILVVDNTRKFLS  103 (497)
Q Consensus        24 ~~~d~~i~~i~~DSr~v~~g~lFval~G~~~dGh~fi~~A~~~GA~~~i~~~~~~~~~~~~~~~~~~p~i~V~d~~~aL~  103 (497)
                      ...+++|++|++|||+|+||||||||+|+++|||+|+++|+++||+++|++++.+..........++|+++|+|++++|+
T Consensus        15 ~~~~~~i~~i~~DSR~v~~g~lFval~G~~~DGh~fi~~A~~~GA~~vv~~~~~~~~~~~~~~~~~~~~i~V~d~~~aL~   94 (498)
T 1e8c_A           15 DAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLS   94 (498)
T ss_dssp             TCCCCBCCCEESCGGGCCTTCEEEECBCSSCBGGGGHHHHHHTTCSEEEEECTTTCCTTCEEEETTEEEEEETTHHHHHH
T ss_pred             CCCCCEECCEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCHHHCCCCCCEEEECCHHHHHH
T ss_conf             99887379278506758999789990468888899999999879969998075334541010037985899899999999


Q ss_pred             HHHHHHHCCCCC--CEEEEEEEECCCEEHHHHHHHHHHCCCCCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHCCC
Q ss_conf             999998276200--224565430652000123333321023222223454433-23554457675312211111110112
Q gi|254781102|r  104 LFASRLYGKHPE--NILAVTGTSGKSSVASFVQQICQRSGLSSFQIGPTSTIS-SFAQDNRLTTPSPIYLAKALSYLSSQ  180 (497)
Q Consensus       104 ~la~~~~~~~~~--~vIgITGTnGKTTt~~~l~~iL~~~g~~~~~~g~~~~~~-~~~~~~~~TtP~~~~l~~~l~~~~~~  180 (497)
                      +||++||++++.  ++||||||||||||++|++++|+..+.+++..|+.++.. ........++|++..++.+|..+.+.
T Consensus        95 ~la~~~~~~~~~~~~vIgITGSnGKTTT~~~l~~iL~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~  174 (498)
T 1e8c_A           95 ALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQ  174 (498)
T ss_dssp             HHHHHHTTCGGGSSEEEEEESSSCHHHHHHHHHHHHHHTTCCEEEEETTEEEETTCCBCCSSSSCCHHHHHHHHHHHHHT
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCCCCCEEECCHHHHHHCCCCCEECCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             99999855733367189997899980006460004554375300025400134752245578787356789999998856


Q ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHC
Q ss_conf             23333356676665554310432121112321545543211011223455421000000122321112542000122210
Q gi|254781102|r  181 GVTHVSVEASSHGLDQHRLDGIKLIAGSFTNLGRDHIDYHQTQQAYFNAKMRLFEELLPKESPAIIYADDAYSKEVMKRA  260 (497)
Q Consensus       181 g~~~~vlEvSS~gl~~~rl~~i~~diaviTNI~~dHLd~~gs~e~y~~aK~~If~~~~~~~~~~ViN~Dd~~~~~l~~~~  260 (497)
                      +++++++|+||+|+.+.++..++|+++|||||++||||+|||+++|+++|.++|..  ++.+.+|+|.||++...+.+..
T Consensus       175 ~~~~~~~e~s~~g~~~~~~~~~~p~iaviTNI~~dHl~~~gs~e~~~~aK~~i~~~--~~~g~~vln~Dd~~~~~~~~~~  252 (498)
T 1e8c_A          175 GATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSE--HHCGQAIINADDEVGRRWLAKL  252 (498)
T ss_dssp             TCCEEEEECCHHHHHTTTTTTCBCSEEEECCCCSCCHHHHSSHHHHHHHHHHHHHT--SBCCEEEEETTSHHHHHHHTTC
T ss_pred             CCCEEEEECCCCCHHHHHHCCCCCCEEEEECCCHHHCCCCCCHHHHHHHHHHHHHH--CCCCEEEEECCCHHHHHHHHHC
T ss_conf             99299990698364556407688888999489778767568836767788886530--3677289935867887777650


Q ss_pred             CCCCCCCCCCCC----CCCCCCCCEECCCCCCCCCCCCCCCCEEECCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             235653222223----3332200000014544432112221001012234332221105778887752026767631112
Q gi|254781102|r  261 HNAGCRVLSVGY----QGKFIHLKKVCAIHNKQQVTISVEGKDFDFLFPLPGEFQVYNALVAAGLCIAIGIDSALVLEHL  336 (497)
Q Consensus       261 ~~~~~~~~~~g~----~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~l~G~hni~NalaAia~a~~lGi~~~~i~~~L  336 (497)
                      ..........+.    .........+.....+..+.+..+++.+++.++++|.||++|+++|++++..+|++++++.+++
T Consensus       253 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~l~G~hnv~NalaAia~a~~lg~~~~~i~~~l  332 (498)
T 1e8c_A          253 PDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTA  332 (498)
T ss_dssp             TTCEEEESSSCCCTTTCSEEEEEEEEEECSSCEEEEEEETTCCEEEEECSCSHHHHHHHHHHHHHHHHTTCCHHHHHHHG
T ss_pred             CCCEEEEECCCCCCCCCCCCEEEEEEEECCCCCEEEECCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             46258863145675433420000246522665201100467643688751273799999999999976221258999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHCCEEEEC
Q ss_conf             34433455210001355786023000378689999741211002344403540266546004689999998619899990
Q gi|254781102|r  337 EKLHVVPGRFEFVGTNSRGGRIYVDYAHTSNSLEMILKNIRTITSGRIIVVFGCGGDRDQGKRPIMGKIALDLADIAIVT  416 (497)
Q Consensus       337 ~~f~~~~gR~E~i~~~~~~~~viiDyahNP~s~~~aL~~l~~~~~~r~i~V~G~~Gdrd~~kr~~mg~~a~~~ad~vi~t  416 (497)
                      .+|++++||||.+... ++..+++||||||+||+++++++++++++|+++|+|+||+|+..+|++|++++.+++|.+|+|
T Consensus       333 ~~~~~~~gR~e~~~~~-~~~~iidDy~~np~s~~a~l~~l~~~~~~rii~v~g~~g~~~~~~~~~~~~~a~~~~d~vilt  411 (498)
T 1e8c_A          333 ARLQPVCGRMEVFTAP-GKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVT  411 (498)
T ss_dssp             GGCCCCTTSSEEECCT-TSCEEEEECCCSHHHHHHHHHHHHHTCSSCEEEEECCCSSSCSTHHHHHHHHHHHHCSEEEEC
T ss_pred             HHCCCCCCCEEEEEEC-CCEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEC
T ss_conf             7458989972899938-954999942799299999999988656998899988766665215589999998559999999


Q ss_pred             CCCCCCCCHHHHHHHHHHCCC---CEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCCCEEECCCEECCCCHHHHHHHHH
Q ss_conf             887989898999999983479---80997898999999999658988999944688663584497886799899999984
Q gi|254781102|r  417 DDNPRSEDPEKIRAEIIHGIP---GFIEKGNRIEAIRTAIEMLNKQDVLVVAGKGHETVHIVTNGEKKMSVDCDIIREIL  493 (497)
Q Consensus       417 ~d~~r~e~~~~I~~~i~~g~~---~~~~~~dr~eAi~~A~~~a~~gDvili~GkG~e~~~~~~~~~~~~~~d~~~~~~~l  493 (497)
                      +|+||+|+|..|+.++.+++.   ++..+.|+.||++.|.++++|||+|||+|||||+||++. +.+.||+||++|||+|
T Consensus       412 ~~~~~~e~~~~i~~~~~~~~~~~~~~~~~~d~~eAi~~a~~~a~~gDvVLi~G~G~e~~~~~~-~~~~~f~d~~~~~~~~  490 (498)
T 1e8c_A          412 DDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVG-NQRLDYSDRVTVARLL  490 (498)
T ss_dssp             CSCCBTSCHHHHHHHHHTTSSCGGGSEECSCHHHHHHHHHHHSCTTCEEEEESCTTCCEEEET-TEEEECCHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCCEEEEC-CEEECCCHHHHHHHHH
T ss_conf             878787798999999985676778879968999999999984899899999478887849989-9986898699999999


Q ss_pred             HHH
Q ss_conf             430
Q gi|254781102|r  494 GLI  496 (497)
Q Consensus       494 ~~~  496 (497)
                      +.+
T Consensus       491 ~~~  493 (498)
T 1e8c_A          491 GVI  493 (498)
T ss_dssp             TSC
T ss_pred             HHH
T ss_conf             888



>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D- alanyl-D-alanine ligase, MURF protein...; HET: 1LG; 2.50A {Streptococcus pneumoniae R6} PDB: 2am2_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure