254781103

254781103

penicillin-binding transmembrane protein

GeneID in NCBI database:8210128Locus tag:CLIBASIA_05025
Protein GI in NCBI database:254781103Protein Accession:YP_003065516.1
Gene range:-(1103164, 1104960)Protein Length:598aa
Gene description:penicillin-binding transmembrane protein
COG prediction:[M] Cell division protein FtsI/penicillin-binding protein 2
KEGG prediction:penicillin-binding transmembrane protein; K03587 cell division protein FtsI (penicillin-binding protein 3) [EC:2.4.1.129]
SEED prediction:Cell division protein FtsI [Peptidoglycan synthetase] (EC 2.4.1.129)
Pathway involved in KEGG:Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Bacterial Cell Division;
Flagellum in Campylobacter;
Peptidoglycan Biosynthesis;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED5 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------60
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
ccccEEEHHHHHHHHHHHHHcccccccEEccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHHHHHHHcccccEEEEcccccEEEcccccEEEccEEEEEEEEEHHHHccHHHHHHHHHHHccccHHHHHHHHHccccccEEEcccccHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHcccccHHHEEEcccEEEEccEEEEcccccccEEEHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHHHcccEEEccEEEEEEEccccccccccccHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEcccccccccccccEEEEEEEEcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccc
ccccEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccEEEEccccccccEEcccccEEEEEccccEEEEcHHHHccHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEEcccHHHHHHHHHcccccEEEccccccccccccEEEEEEEEEcccccccccHHHHccccccEEEEEccccccccccEEEEHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEEEccccccccccccccHHHHHcccHHccccccccHHHHHHHHHHHccccccccEEcccccEEEcccEEEccccccccccHHHHEEccccHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccHcHHHHHHHHHHHHHHccccEcccEEEEHccccccccccEEccHHHHHHHHHHHHHHcccccccEEEEcccEEEEEccccEEccccccccccEEEEEEEEccccccEEEEEEEEEccccccccccEccEEccHHHHHHHHHHHHHccccccccc
MIFPFITVSQFRMFFSMGIlhnhnmnmshnsanisfrnmesghnlcqkgchmedgQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIqygnihpepiapsmnideygmsrpdiidrngeilatdiptfslyvephkvispdEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILsfglpgvgfrleksrfypaashashvvgyvdidnrgitgiekfldmqgltrvfttnkgeknlqPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGevismvsipdydpheafkgkkegwfnRISYGIFEMGSIFKVFTIAMgidsglftvkdlfdtrnpikvgkhvihdyhpqnriltipeifryssnigAAQIADAMGIQGHKEFLYRLGLLSkletelpeiqapsypsqwkrIHSLTisfghglsttPLQTAVAAAALInegrlipptfmirsrEESEKVSRIVLKKNTVKTMRSLLRegvtggsgrrafvpgfevggktgTAQKVIKKRYsdtlnfnsflavfpttdpqyIVLSfmdspkikernqltaginvapMVGNIIRRSAsmlgvkpvflk
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIahsknrigmtiVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSsetkfqwlrrklspqqqkrilsfglPGVGFRLEKSRFYpaashashvvgyVDIDNRGITGIEKFLDMQGLTRVFTtnkgeknlQPIRLALDLRIQNIVHQELvenkkkynaeSVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGkhvihdyhpqnRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINegrlipptfmirsreesekvsrivlkkntvktmrsllregvtggsgrrafvpgfevggktgtaqKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRrsasmlgvkpvflk
MIFPFITVSQFRMFFSMGILhnhnmnmshnsANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLViyiilairiiQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
MIFPFITVSQFRMFFSMGILHNHN***********************************************NRIGMTIVVCLVIYIILAIRIIQYGN****************MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF******KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR***********VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP****
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANIS*RNM*SGHN**********GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target598 penicillin-binding transmembrane protein [Candidatus Li
254780752817 penicillin binding peptidoglycan synthetase protei 2e-04
>gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Back     alignment
 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 79/198 (39%), Gaps = 43/198 (21%)

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
           G + ++  TG +++ +    Y   E         FNR +  + + GS FK    A  +DS
Sbjct: 442 GLIAMDPRTGRILATIGGFSYSQSE---------FNRSTQAMRQPGSCFKPIVYAAALDS 492

Query: 345 GLFTVKDLFDTRNPIKV---GKHVIHDYHPQN--RILTIPEIFRY----SSNIGAAQIAD 395
           G      + D   PI+V   GK     + P+N  +  +     R+    S N+   ++A 
Sbjct: 493 GYTPASVIMDA--PIEVVSRGKI----WKPENYSKNFSGASTLRFGLEKSRNLMTVRLAH 546

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
            MG+    ++    G+  K+   LP                  +S G G  TT L+   A
Sbjct: 547 NMGMTVVADYAENFGIYDKMLPVLP------------------MSLGAG-ETTVLRMVSA 587

Query: 456 AAALINEGRLIPPTFMIR 473
            A   N G+ I P+F+ R
Sbjct: 588 YAVFANGGKQIRPSFIDR 605

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target598 penicillin-binding transmembrane protein [Candidatus Li
315122413577 penicillin-binding transmembrane protein [Candidatus Li 1 0.0
15965935582 penicillin-binding transmembrane protein [Sinorhizobium 1 1e-180
150397289582 peptidoglycan glycosyltransferase [Sinorhizobium medica 1 1e-179
227822657582 penicillin-binding protein 3 [Sinorhizobium fredii NGR2 1 1e-177
325293471580 penicillin binding protein 2 [Agrobacterium sp. H13-3] 1 1e-172
15889384580 penicillin binding protein 2 [Agrobacterium tumefaciens 1 1e-172
222086450583 cell division penicillin-binding protein [Agrobacterium 1 1e-168
222149142583 penicillin binding protein 2 [Agrobacterium vitis S4] L 1 1e-164
190892589585 cell division penicillin-binding protein [Rhizobium etl 1 1e-160
327194628578 cell division penicillin-binding protein [Rhizobium etl 1 1e-160
>gi|315122413|ref|YP_004062902.1| penicillin-binding transmembrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 577 Back     alignment and organism information
 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/598 (75%), Positives = 512/598 (85%), Gaps = 21/598 (3%)

Query: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60
           MIFPFI +S+F+ FFSM        N + N  NI  +NME             + Q  F 
Sbjct: 1   MIFPFIILSRFQAFFSM--------NTTSNGENIQIKNME-------------NRQRRFH 39

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KRR+KVIA SKNRIG+TIV C++IYII AIR+IQYGN+  EPI    N++EYG SRPDII
Sbjct: 40  KRRKKVIAQSKNRIGITIVFCIIIYIIFAIRLIQYGNLQLEPIIHLTNVEEYGTSRPDII 99

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNGEILATDI TFSLY EPHKVIS DEII+KLQ+VLPNLD ++IRRKL S+TKFQWLRR
Sbjct: 100 DRNGEILATDIRTFSLYAEPHKVISADEIIKKLQVVLPNLDIKVIRRKLLSKTKFQWLRR 159

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
           +LSPQQQKRIL+FGLPG+GFR+EK RFYPA+SH  HVVGYVDIDN GI+GIEKF+DMQGL
Sbjct: 160 QLSPQQQKRILNFGLPGLGFRIEKRRFYPASSHTLHVVGYVDIDNHGISGIEKFIDMQGL 219

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
           T   T  KGEKNL PIRL+LDLRIQNIVHQ LVEN +KY AES GTVI+NVSTGE+ISMV
Sbjct: 220 TSRSTIEKGEKNLPPIRLSLDLRIQNIVHQSLVENMQKYKAESAGTVIINVSTGEIISMV 279

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           SIPD+DPHEA KG KEGW NR+SYGIFEMGSIFK FTIAM IDSGLFTVKD FDTR PI+
Sbjct: 280 SIPDHDPHEAVKGGKEGWLNRVSYGIFEMGSIFKAFTIAMAIDSGLFTVKDSFDTRYPIQ 339

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
            GK+ I+D+HP +R+LTI EIFRYSSNIGAA+IADA+GI+ HK FL++LGLL+KLETELP
Sbjct: 340 QGKYFINDFHPHSRMLTIAEIFRYSSNIGAARIADAIGIEEHKNFLHKLGLLTKLETELP 399

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EI+APSYPS+WKR+HSLTISFGHGLSTTPLQTAVAAAALIN G+LIPPTFM+RSREE+EK
Sbjct: 400 EIKAPSYPSKWKRVHSLTISFGHGLSTTPLQTAVAAAALINGGQLIPPTFMVRSREEAEK 459

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
            SRI+LKK TV+TMRSLLREGV  GSG+RAFVPGFEVGGKTGTAQKVI  RYS+ LNFN+
Sbjct: 460 KSRIILKKKTVETMRSLLREGVMSGSGKRAFVPGFEVGGKTGTAQKVIGNRYSNELNFNT 519

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLA FP ++PQY+VLSFMDSPKIKE+NQLTAGINVAPMVG+IIRRSASMLGVKP FLK
Sbjct: 520 FLATFPASNPQYVVLSFMDSPKIKEQNQLTAGINVAPMVGDIIRRSASMLGVKPTFLK 577


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965935|ref|NP_386288.1| penicillin-binding transmembrane protein [Sinorhizobium meliloti 1021] Length = 582 Back     alignment and organism information
>gi|150397289|ref|YP_001327756.1| peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419] Length = 582 Back     alignment and organism information
>gi|227822657|ref|YP_002826629.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234] Length = 582 Back     alignment and organism information
>gi|325293471|ref|YP_004279335.1| penicillin binding protein 2 [Agrobacterium sp. H13-3] Length = 580 Back     alignment and organism information
>gi|15889384|ref|NP_355065.1| penicillin binding protein 2 [Agrobacterium tumefaciens str. C58] Length = 580 Back     alignment and organism information
>gi|222086450|ref|YP_002544984.1| cell division penicillin-binding protein [Agrobacterium radiobacter K84] Length = 583 Back     alignment and organism information
>gi|222149142|ref|YP_002550099.1| penicillin binding protein 2 [Agrobacterium vitis S4] Length = 583 Back     alignment and organism information
>gi|190892589|ref|YP_001979131.1| cell division penicillin-binding protein [Rhizobium etli CIAT 652] Length = 585 Back     alignment and organism information
>gi|327194628|gb|EGE61478.1| cell division penicillin-binding protein [Rhizobium etli CNPAF512] Length = 578 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target598 penicillin-binding transmembrane protein [Candidatus Li
TIGR02214636 TIGR02214, spoVD_pbp, stage V sporulation protein D 3e-60
TIGR03423592 TIGR03423, pbp2_mrdA, penicillin-binding protein 2 8e-59
PRK10795634 PRK10795, PRK10795, penicillin-binding protein 2; Provi 2e-19
pfam00905296 pfam00905, Transpeptidase, Penicillin binding protein t 3e-48
COG4953 733 COG4953, PbpC, Membrane carboxypeptidase/penicillin-bin 9e-07
PRK15105578 PRK15105, PRK15105, peptidoglycan synthase FtsI; Provis 7e-43
COG0768599 COG0768, FtsI, Cell division protein FtsI/penicillin-bi 1e-101
pfam03717165 pfam03717, PBP_dimer, Penicillin-binding Protein dimeri 5e-23
COG0744661 COG0744, MrcB, Membrane carboxypeptidase (penicillin-bi 1e-19
TIGR02074530 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A f 2e-19
TIGR02073 727 TIGR02073, PBP_1c, penicillin-binding protein 1C 3e-04
COG5009797 COG5009, MrcA, Membrane carboxypeptidase/penicillin-bin 1e-11
>gnl|CDD|131269 TIGR02214, spoVD_pbp, stage V sporulation protein D Back     alignment and domain information
>gnl|CDD|163256 TIGR03423, pbp2_mrdA, penicillin-binding protein 2 Back     alignment and domain information
>gnl|CDD|182738 PRK10795, PRK10795, penicillin-binding protein 2; Provisional Back     alignment and domain information
>gnl|CDD|144486 pfam00905, Transpeptidase, Penicillin binding protein transpeptidase domain Back     alignment and domain information
>gnl|CDD|34561 COG4953, PbpC, Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|185060 PRK15105, PRK15105, peptidoglycan synthase FtsI; Provisional Back     alignment and domain information
>gnl|CDD|31111 COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|146381 pfam03717, PBP_dimer, Penicillin-binding Protein dimerization domain Back     alignment and domain information
>gnl|CDD|31087 COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162686 TIGR02074, PBP_1a_fam, penicillin-binding protein, 1A family Back     alignment and domain information
>gnl|CDD|162685 TIGR02073, PBP_1c, penicillin-binding protein 1C Back     alignment and domain information
>gnl|CDD|34614 COG5009, MrcA, Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 598 penicillin-binding transmembrane protein [Candidatus Li
TIGR02214660 spoVD_pbp stage V sporulation protein D; InterPro: IPR0 100.0
TIGR03423592 pbp2_mrdA penicillin-binding protein 2. Members of this 100.0
PRK10795619 penicillin-binding protein 2; Provisional 100.0
COG0768599 FtsI Cell division protein FtsI/penicillin-binding prot 100.0
pfam00905296 Transpeptidase Penicillin binding protein transpeptidas 100.0
PRK11636850 mrcA peptidoglycan synthetase; Provisional 100.0
COG5009797 MrcA Membrane carboxypeptidase/penicillin-binding prote 100.0
pfam00768241 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase. 98.56
COG2367329 PenP Beta-lactamase class A [Defense mechanisms] 97.81
TIGR02074700 PBP_1a_fam penicillin-binding protein, 1A family; Inter 100.0
PRK09506839 mrcB penicillin-binding protein 1b; Reviewed 100.0
PRK11240 770 penicillin-binding protein 1C; Provisional 100.0
COG0744661 MrcB Membrane carboxypeptidase (penicillin-binding prot 100.0
TIGR02073 786 PBP_1c penicillin-binding protein 1C; InterPro: IPR0118 100.0
TIGR02071742 PBP_1b penicillin-binding protein 1B; InterPro: IPR0118 100.0
COG4953 733 PbpC Membrane carboxypeptidase/penicillin-binding prote 100.0
COG2602254 Beta-lactamase class D [Defense mechanisms] 99.64
pfam03717165 PBP_dimer Penicillin-binding Protein dimerization domai 99.96
PRK10001400 D-alanyl-D-alanine carboxypeptidase fraction C; Provisi 98.42
PRK11669308 pbpG D-alanyl-D-alanine endopeptidase; Provisional 98.4
PRK11397390 dacD D-alanyl-D-alanine carboxypeptidase; Provisional 97.8
PRK10793403 D-alanyl-D-alanine carboxypeptidase fraction A; Provisi 97.79
COG1686389 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope 97.64
pfam00144327 Beta-lactamase Beta-lactamase. This family appears to b 96.19
PRK10662377 beta-lactamase/D-alanine carboxypeptidase; Provisional 97.56
PRK11289387 ampC beta-lactamase; Provisional 95.4
PRK12357326 glutaminase; Reviewed 96.19
pfam04960286 Glutaminase Glutaminase. This family of enzymes deamina 95.61
COG2066309 GlsA Glutaminase [Amino acid transport and metabolism] 90.85
PRK00971308 glutaminase; Provisional 96.13
PRK12356319 glutaminase; Reviewed 95.71
PRK11113477 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Prov 94.63
pfam02113383 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) fami 90.56
>TIGR02214 spoVD_pbp stage V sporulation protein D; InterPro: IPR011927 This entry describes the SpoVD family of homologs of the cell division protein FtsI, a penicillin binding protein Back     alignment and domain information
>TIGR03423 pbp2_mrdA penicillin-binding protein 2 Back     alignment and domain information
>PRK10795 penicillin-binding protein 2; Provisional Back     alignment and domain information
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain Back     alignment and domain information
>PRK11636 mrcA peptidoglycan synthetase; Provisional Back     alignment and domain information
>COG5009 MrcA Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase Back     alignment and domain information
>COG2367 PenP Beta-lactamase class A [Defense mechanisms] Back     alignment and domain information
>TIGR02074 PBP_1a_fam penicillin-binding protein, 1A family; InterPro: IPR011816 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed Back     alignment and domain information
>PRK11240 penicillin-binding protein 1C; Provisional Back     alignment and domain information
>COG0744 MrcB Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02073 PBP_1c penicillin-binding protein 1C; InterPro: IPR011815 This entry contains penicillin binding proteins includes the member from Escherichia coli designated penicillin-binding protein 1C Back     alignment and domain information
>TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813 Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task Back     alignment and domain information
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2602 Beta-lactamase class D [Defense mechanisms] Back     alignment and domain information
>pfam03717 PBP_dimer Penicillin-binding Protein dimerization domain Back     alignment and domain information
>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional Back     alignment and domain information
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional Back     alignment and domain information
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam00144 Beta-lactamase Beta-lactamase Back     alignment and domain information
>PRK10662 beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK11289 ampC beta-lactamase; Provisional Back     alignment and domain information
>PRK12357 glutaminase; Reviewed Back     alignment and domain information
>pfam04960 Glutaminase Glutaminase Back     alignment and domain information
>COG2066 GlsA Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00971 glutaminase; Provisional Back     alignment and domain information
>PRK12356 glutaminase; Reviewed Back     alignment and domain information
>PRK11113 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional Back     alignment and domain information
>pfam02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target598 penicillin-binding transmembrane protein [Candidatus Li
3oc2_A564 Crystal Structure Of Penicillin-Binding Protein 3 F 1e-98
3pbn_A538 Crystal Structure Of Apo Pbp3 From Pseudomonas Aeru 9e-95
3eqv_A542 Crystal Structure Of Penicillin-Binding Protein 2 F 1e-94
3equ_A542 Crystal Structure Of Penicillin-Binding Protein 2 F 4e-92
1rp5_A 702 Pbp2x From Streptococcus Pneumoniae Strain 5259 Wit 7e-45
1k25_A 685 Pbp2x From A Highly Penicillin-Resistant Streptococ 1e-44
1qme_A 702 Penicillin-Binding Protein 2x (Pbp-2x) Length = 702 5e-44
1pyy_A 702 Double Mutant Pbp2x T338aM339F FROM STREPTOCOCCUS P 6e-44
1vqq_A646 Structure Of Penicillin Binding Protein 2a From Met 2e-35
1mws_A646 Structure Of Nitrocefin Acyl-Penicillin Binding Pro 9e-35
1pmd_A 675 Penicillin-Binding Protein 2x (Pbp-2x) Length = 675 2e-41
3lo7_A483 Crystal Structure Of Pbpa From Mycobacterium Tuberc 2e-34
2wae_A680 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 3e-28
2wad_A680 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 7e-28
2waf_A682 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 1e-27
1mwr_A646 Structure Of Semet Penicillin Binding Protein 2a Fr 2e-32
2wae_A 680 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 7e-11
2wad_A 680 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 7e-11
2z2l_B385 Penicillin-Binding Protein 2x (Pbp2x) From Streptoc 1e-27
2waf_A 682 Penicillin-Binding Protein 2b (Pbp-2b) From Strepto 6e-11
>gi|311772227|pdb|3OC2|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 From Pseudomonas Aeruginosa Length = 564 Back     alignment and structure
 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 143/537 (26%), Positives = 256/537 (47%), Gaps = 31/537 (5%)

Query: 83  VIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHK 142
           V++    + +I +  +  +  A S+        R  I DRNGE LA   P  +L+  P +
Sbjct: 14  VLFQGPDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTTLWANPKE 73

Query: 143 VISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLSPQQQKRILSFGLPGVGF 200
           +++  E   +L   L   D+++   ++      +F +L R L+P+Q + +++  +PGV  
Sbjct: 74  LMTAKERWPQLAAALGQ-DTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIALKVPGVYS 132

Query: 201 RLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE----- 250
             E  RFYPA    +H VG+ D+D+RG  GIE   D       G  +V    +G      
Sbjct: 133 IEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRRGRVIKDV 192

Query: 251 ------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
                 K  + + L++DLR+Q + H+EL     +  A++   VI++V TGE+++M + P 
Sbjct: 193 QVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEILAMTNQPT 252

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD-LFDTRNPIKVGK 363
           Y+P+     +     NR    +FE GS  K F+++  + SG +   D +      +++G+
Sbjct: 253 YNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYPGTLQIGR 312

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
           + I D    +R L +  I   SSN+G ++IA  +G +     + ++GL        P  +
Sbjct: 313 YTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTGLGFPGER 372

Query: 424 APS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
             +     +W +  + T+++G+GLS T +Q A A AAL N+G+ +P +     R      
Sbjct: 373 VGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLSMTRVDRVPDGV- 431

Query: 482 SRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKK--RYSDTLNF 538
              V+      T++ +L++ V   G   RA VPG+   GK+GTA+KV      Y +    
Sbjct: 432 --QVISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKGYRENAYR 489

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++ V P 
Sbjct: 490 SLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLMNVPPD 543


>gi|315364688|pdb|3PBN|A Chain A, Crystal Structure Of Apo Pbp3 From Pseudomonas Aeruginosa Length = 538 Back     alignment and structure
>gi|209870568|pdb|3EQV|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Containing Four Mutations Associated With Penicillin Resistance Length = 542 Back     alignment and structure
>gi|209870566|pdb|3EQU|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Length = 542 Back     alignment and structure
>gi|42543579|pdb|1RP5|A Chain A, Pbp2x From Streptococcus Pneumoniae Strain 5259 With Reduced Susceptibility To Beta-Lactam Antibiotics Length = 702 Back     alignment and structure
>gi|16974968|pdb|1K25|A Chain A, Pbp2x From A Highly Penicillin-Resistant Streptococcus Pneumoniae Clinical Isolate Length = 685 Back     alignment and structure
>gi|8569396|pdb|1QME|A Chain A, Penicillin-Binding Protein 2x (Pbp-2x) Length = 702 Back     alignment and structure
>gi|37927671|pdb|1PYY|A Chain A, Double Mutant Pbp2x T338aM339F FROM STREPTOCOCCUS Pneumoniae Strain R6 At 2.4 A Resolution Length = 702 Back     alignment and structure
>gi|58177060|pdb|1VQQ|A Chain A, Structure Of Penicillin Binding Protein 2a From Methicillin Resistant Staphylococcus Aureus Strain 27r At 1.80 A Resolution. Length = 646 Back     alignment and structure
>gi|24987839|pdb|1MWS|A Chain A, Structure Of Nitrocefin Acyl-Penicillin Binding Protein 2a From Methicillin Resistant Staphylococcus Aureus Strain 27r At 2.00 A Resolution. Length = 646 Back     alignment and structure
>gi|157833527|pdb|1PMD|A Chain A, Penicillin-Binding Protein 2x (Pbp-2x) Length = 675 Back     alignment and structure
>gi|291463677|pdb|3LO7|A Chain A, Crystal Structure Of Pbpa From Mycobacterium Tuberculosis Length = 483 Back     alignment and structure
>gi|224036198|pdb|2WAE|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain 5204) Length = 680 Back     alignment and structure
>gi|224036195|pdb|2WAD|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain 5204) Length = 680 Back     alignment and structure
>gi|224036199|pdb|2WAF|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain R6) Length = 682 Back     alignment and structure
>gi|24987837|pdb|1MWR|A Chain A, Structure Of Semet Penicillin Binding Protein 2a From Methicillin Resistant Staphylococcus Aureus Strain 27r (Trigonal Form) At 2.45 A Resolution. Length = 646 Back     alignment and structure
>gi|224036198|pdb|2WAE|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain 5204) Length = 680 Back     alignment and structure
>gi|224036195|pdb|2WAD|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain 5204) Length = 680 Back     alignment and structure
>gi|158431327|pdb|2Z2L|B Chain B, Penicillin-Binding Protein 2x (Pbp2x) From Streptococcus Pneumoniae Length = 385 Back     alignment and structure
>gi|224036199|pdb|2WAF|A Chain A, Penicillin-Binding Protein 2b (Pbp-2b) From Streptococcus Pneumoniae (Strain R6) Length = 682 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target598 penicillin-binding transmembrane protein [Candidatus Li
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 1e-80
1qme_A 702 Penicillin-binding protein 2X; peptidoglycan synthesis, 7e-61
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 9e-55
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 1e-45
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 2e-50
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 2e-15
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 1e-26
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 2e-25
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 4e-25
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 7e-25
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 4e-19
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 5e-19
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 2e-17
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 6e-17
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 8e-17
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 2e-13
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 1e-09
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 0.001
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 0.004
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 2e-24
2wad_A 680 Penicillin-binding protein 2B; peptidoglycan synthesis, 2e-06
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 1e-18
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 5e-09
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 0.002
>3oc2_A Penicillin-binding protein 3; structu genomics, oxford protein production facility, OPPF, transpe cell WALL biosynthesis; 1.97A {Pseudomonas aeruginosa} PDB: 3ocl_A* 3ocn_A* Length = 564 Back     alignment and structure
 Score =  296 bits (758), Expect = 1e-80
 Identities = 144/521 (27%), Positives = 253/521 (48%), Gaps = 40/521 (7%)

Query: 98  IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVL 157
           +    I            R  I DRNGE LA   P  +L+  P ++++  E   +L   L
Sbjct: 38  VRHIAIPAH---------RGLITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAAL 88

Query: 158 PNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
              D+++   ++  ++E +F +L R L+P+Q + +++  +PGV    E  RFYPA    +
Sbjct: 89  -GQDTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVA 147

Query: 216 HVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLA 259
           H VG+ D+D+RG  GIE   D       G  +V    +G            K  + + L+
Sbjct: 148 HAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALS 207

Query: 260 LDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWF 319
           +DLR+Q + H+EL     +  A++   VI++V TGE+++M + P Y+P+     +     
Sbjct: 208 IDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNLQPAAMR 267

Query: 320 NRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTI 378
           NR    +FE GS  K F+++  + SG +   D+ D     +++G++ I D    +R L +
Sbjct: 268 NRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDL 327

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHS 436
             I   SSN+G ++IA  +G +     + ++GL        P  +  + P   +W +  +
Sbjct: 328 TGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAET 387

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRS 496
            T+++G+GLS T +Q A A AAL N+G+ +P +     R +       V+      T++ 
Sbjct: 388 ATLAYGYGLSVTAIQLAHAYAALANDGKSVPLSMT---RVDRVPDGVQVISPEVASTVQG 444

Query: 497 LLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVI--KKRYSDTLNFNSFLAVFPTTDPQYI 553
           +L++ V   G   RA VPG+   GK+GTA+KV    K Y +    + F    P TDP+  
Sbjct: 445 MLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRIA 504

Query: 554 VLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           ++  +D P    +     G+  AP+   ++  +  ++ V P
Sbjct: 505 MVVVIDEPS---KAGYFGGLVSAPVFSKVMAGALRLMNVPP 542


>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C* Length = 702 Back     alignment and structure
>3equ_A PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Length = 542 Back     alignment and structure
>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwr_A 1mws_A* 1mwt_A* 1mwu_A* Length = 646 Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Length = 483 Back     alignment and structure
>2bg1_A PBP1B, penicillin-binding protein 1B; peptidoglycan, peptidoglycan synthesis multifunctional enzyme, cell WALL; 1.9A {Streptococcus pneumoniae} SCOP: e.3.1.1 PDB: 2uwy_A* 2uwx_A* 2fff_B Length = 494 Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Length = 318 Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Length = 262 Back     alignment and structure
>1k38_A Penicillinase, beta-lactamase OXA-2; serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine; HET: KCX; 1.50A {Salmonella typhimurium} SCOP: e.3.1.1 Length = 254 Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Length = 390 Back     alignment and structure
>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Length = 751 Back     alignment and structure
>1k55_A Beta lactamase OXA-10; antibiotic resistance, carbamylation, hydrolase; HET: KCX SO4; 1.39A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1e4d_A* 1ewz_A 1k54_A* 1e3u_A* 1k56_A* 1k57_A* 1k4f_A* 1k4e_A* 1k6r_A* 1k6s_A* 1fof_A 1e3u_D 2hpb_A 2hp9_A 2hp6_A 2wgi_A* 2rl3_A* 2hp5_A 1h8z_A 1h8y_A* ... Length = 246 Back     alignment and structure
>2iwb_A Methicillin resistance MECR1 protein; antibiotic resistance, bacterial antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, MRSA; 1.8A {Staphylococcus aureus} PDB: 2iwc_A* 2iwd_A* Length = 246 Back     alignment and structure
>1xkz_A Regulatory protein BLAR1; beta-lactam receptor, signal transduction, signaling protein; HET: CAZ EPE; 1.75A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1xa1_A* 1xa7_A* Length = 255 Back     alignment and structure
>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Length = 244 Back     alignment and structure
>3isg_A Penicillinase, beta-lactamase OXA-1; hydrolase, lysine carboxylation, antibiotic resistance, plasmid, transposable element; HET: KCX DRW; 1.40A {Escherichia coli} PDB: 1m6k_A* Length = 251 Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Length = 669 Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Length = 258 Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Length = 271 Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Length = 680 Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Length = 680 Back     alignment and structure
>3hbr_A OXA-48; class D beta-lactamase, antibiotic, dimer, hydrolase; HET: KCX; 1.90A {Klebsiella pneumoniae} Length = 265 Back     alignment and structure
>2jch_A Penicillin-binding protein 1B; peptidoglycan synthesis multifunctional enzyme, cell WALL, peptidoglycan, gamma lactam antibiotics; HET: PL7; 2.4A {Streptococcus pneumoniae} PDB: 2jci_A* 2je5_A* Length = 720 Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Length = 266 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target598 penicillin-binding transmembrane protein [Candidatus Li
3oc2_A564 Penicillin-binding protein 3; structu genomics, oxford 100.0
3equ_A542 PBP-2, penicillin-binding protein 2; class B transpepti 100.0
1qme_A 702 Penicillin-binding protein 2X; peptidoglycan synthesis, 100.0
2wad_A680 Penicillin-binding protein 2B; peptidoglycan synthesis, 100.0
1vqq_A646 Saupbp2A, penicillin-binding protein MECA, low-affinity 100.0
3lo7_A483 PBPA, penicillin-binding protein A; transpeptidase doma 100.0
2v2f_F390 Penicillin binding protein 1A; transpeptidase activity, 100.0
3fwm_A751 Penicillin-binding protein 1B; bacterial cell WALL synt 100.0
2olv_A669 Penicillin-binding protein 2; transpeptidase fold, glyc 100.0
2jch_A720 Penicillin-binding protein 1B; peptidoglycan synthesis 100.0
1xkz_A255 Regulatory protein BLAR1; beta-lactam receptor, signal 100.0
1nrf_A262 Regulatory protein BLAR1; penicillin-receptor, beta-lac 100.0
2iwb_A246 Methicillin resistance MECR1 protein; antibiotic resist 100.0
1k38_A254 Penicillinase, beta-lactamase OXA-2; serine beta-lactam 100.0
3g4p_A244 Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme me 100.0
2wuq_A318 BLAB, beta-lactamase regulatory protein BLAB; class A b 100.0
3lez_A260 Beta-lactamase; antibiotic resistance, halotolerant, DE 99.65
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydrolase, 99.62
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiotic re 99.59
2cc1_A262 Beta-lactamase, penicillinase; hydrolase, antibiotic re 99.54
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carbenici 99.51
2wk0_A265 Beta-lactamase; hydrolase, iodopenicillanate, antibioti 99.51
1hzo_A271 Beta-lactamase; mixed alpha/beta, cephalosporinase, hyd 99.44
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, anti 99.41
3m6b_A265 Beta-lactamase, penicillinase; alpha-beta structure, an 99.4
3p09_A290 Beta-lactamase; structural genomics, center for structu 99.39
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hydrolas 99.33
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-terminal 99.33
1bsg_A266 Beta lactamase, penicillinase; hydrolase, antibiotic re 99.3
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural genomi 99.11
2bg1_A494 PBP1B, penicillin-binding protein 1B; peptidoglycan, pe 100.0
1k55_A246 Beta lactamase OXA-10; antibiotic resistance, carbamyla 100.0
3isg_A251 Penicillinase, beta-lactamase OXA-1; hydrolase, lysine 100.0
3hbr_A265 OXA-48; class D beta-lactamase, antibiotic, dimer, hydr 100.0
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam hydrol 99.41
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antibiotic 99.39
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus licheni 99.35
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ultra- 99.64
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1 99.57
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, acylati 99.45
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrop 99.41
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted, ant 99.27
1es5_A262 DD-transpeptidase; penicillin-binding, serine peptidase 98.6
2qz6_A358 Beta-lactamase; psychrophIle, cold adaptation, antibiot 96.66
1z6f_A363 Penicillin-binding protein 5; peptidoglycan synthesis, 98.23
3mfd_A334 D-alanyl-D-alanine carboxypeptidase DACB; penicillin-bi 98.22
1xp4_A379 D-alanyl-D-alanine carboxypeptidase; five-stranded anti 98.21
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2; pen 98.17
3hun_A453 Penicillin-binding protein 4; ampicillin, beta-lactamas 97.72
3a3j_A344 PBP5; penicillin binding protein 5, DACA, hydrolase; 2. 97.7
3ita_A352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-b 97.7
1tvf_A369 PBP4, penicillin binding protein 4; structural genomics 97.4
3ozh_A351 Beta-lactamase/D-alanine carboxypeptidase; structural g 96.48
2qmi_A 447 PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, 97.37
1yqs_A349 D-alanyl-D-alanine carboxypeptidase; cell well biosynth 97.2
1ci9_A392 ESTB, protein (carboxylesterase); hydrolase, caboxylest 96.88
3hlc_A432 Transesterase, LOVD; alpha/beta hydrolase fold, transfe 96.37
1zkj_A359 CMY-10, extended-spectrum beta-lactamase; plasmid, clas 96.32
2wzx_A371 Beta-lactamase; inhibitor, hydrolase, antibiotic resist 96.19
2ffy_A358 Beta-lactamase; AMPC, deacylation, transition state, bo 95.18
2drw_A363 DAA, D-amino acid amidase; penicillin recognizing prote 94.57
3i7j_A280 Beta-lactamase MB2281C; alpha-beta protein., structural 92.12
3czd_A315 Glutaminase kidney isoform; glutamine, glutamate, K-glu 97.3
3ih8_A 456 Salt-tolerant glutaminase; hydrolase; 2.30A {Micrococcu 96.03
2pby_A308 Glutaminase; secsg, riken, structural genomics, PSI, pr 96.0
1u60_A310 Probable glutaminase YBAS; structural genomics, APC5046 94.78
1w5d_A462 Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidas 96.64
1w79_A489 D-alanyl-D-alanine carboxypeptidase; penicillin-binding 96.63
1mki_A330 Probable glutaminase YBGJ; structural genomics, PSI, pr 95.96
3a3d_A453 PBP4, penicillin-binding protein 4; DACB, hydrolase; 1. 95.28
2ex2_A458 Penicillin-binding protein 4; cephem, penem, D- alanyl- 94.9
>3oc2_A Penicillin-binding protein 3; structu genomics, oxford protein production facility, OPPF, transpe cell WALL biosynthesis; 1.97A {Pseudomonas aeruginosa} PDB: 3ocl_A* 3ocn_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=855.99  Aligned_cols=509  Identities=29%  Similarity=0.466  Sum_probs=456.9

Q ss_pred             HHHHHHHHHHHHEEEEEECCHHHHCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEEEHHHHCCHHHHHHHHHHHHCCC
Q ss_conf             99999999864313434415323210004665179974576487081686977999997338099899999998880799
Q gi|254781103|r   81 CLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL  160 (598)
Q Consensus        81 ~~ii~~il~~rl~~lq~~~~~~~~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~i~P~~i~~~~~~~~~L~~il~~~  160 (598)
                      ..|+|.++-+|+++...|+.++.+++++.+.++|+||.||||||++||.|.+.|+|+++|+.+.+.++.+..|+.+| ++
T Consensus        12 ~~~~~~~~~lQv~~~~~y~~~a~~~~~~~~~i~~~RG~I~DrnG~~La~n~~~~~l~~~p~~~~~~~~~~~~la~~l-~~   90 (564)
T 3oc2_A           12 LEVLFQGPDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAAL-GQ   90 (564)
T ss_dssp             -----------------------CCEEEEEEECCCCCCEECTTSCEEEEEEEEEEEEECHHHHTTCGGGHHHHHHHT-TC
T ss_pred             HHHHEEHEEEEEEEHHHHHHHHHHCEEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEEHHHHCCHHHHHHHHHHHH-CC
T ss_conf             74451131179960899999997275786798379985890899998861077699998789379999999999886-88


Q ss_pred             CHHHHHHHHHC--CCCEEEEECCCCHHHHHHHHHHHCCCCEECCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             98999998513--6762896137999999997631013750120233332100000011111124687512310001466
Q gi|254781103|r  161 DSEMIRRKLSS--ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ  238 (598)
Q Consensus       161 ~~~~i~~~l~~--~~~~~~i~r~is~~~~~~I~~~~lpGi~~~~~~~R~YP~~~lashiiGyv~~d~~G~~GlE~~~d~~  238 (598)
                      +.+++.+++++  +++|++|+++|++++.++|.++++|||.+.++++|+||++++++|++||++.|.+|++|||++||..
T Consensus        91 ~~~~~~~~i~~~~~~~~~~l~~~l~~~~~~~i~~~~l~gi~~~~~~~R~Yp~~~~~~~viG~~~~~~~G~~GlE~~y~~~  170 (564)
T 3oc2_A           91 DTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEW  170 (564)
T ss_dssp             CHHHHHHHHHTTTTCSCEEEEEEECHHHHHHHHTTCCTTEEEEEEEEEECTTGGGGHHHHCCBCTTSCBCSHHHHHTHHH
T ss_pred             CHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             99999999986056784898556999999998746899579988776644788643223663445667733400121333


Q ss_pred             -----CCCEEEECC-----------CCCCCCCCCEEEEHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHH
Q ss_conf             -----851689536-----------6676886742555257677777644210011323431112230232032111210
Q gi|254781103|r  239 -----GLTRVFTTN-----------KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI  302 (598)
Q Consensus       239 -----g~~~~~~~~-----------~~~~~g~dI~lTID~~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~  302 (598)
                           |....+...           ..+++|.||+||||.++|+.+|++|.+.++..+++.|++|||||+||+||||||+
T Consensus       171 L~G~~G~~~~~~~~~~~~~~~~~~~~~~~~G~~i~lTiD~~lQ~~ae~~l~~~~~~~~~~~g~~vvmd~~TG~ILAm~s~  250 (564)
T 3oc2_A          171 LAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEILAMTNQ  250 (564)
T ss_dssp             HHCBCEEEEEEECTTCCEEEESSCCBCCBCCCCEEBSCCHHHHHHHHHHHHHHHHHHTCCCEEEEEEETTTCBEEEEEEE
T ss_pred             CCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCEEEEECCC
T ss_conf             05887818999825875211233345688997079996199986589999988863177502699972688838872378


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCC-CCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             014731113444323222223324566432012356544302403204421336-7632221011234543230039998
Q gi|254781103|r  303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEI  381 (598)
Q Consensus       303 P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~-~~~~~~~~~i~~~~~~~g~it~~~a  381 (598)
                      |+||||++.......+.||++++.||||||||||++++|||+|++++++.++|. +.+..+....++++..+|.+++++|
T Consensus       251 P~~d~n~~~~~~~~~~~nra~~~~~~PGStfK~~~~aaAle~g~~~~~~~~~~~~~~~~~g~~~~~~~~~~~g~~~l~~a  330 (564)
T 3oc2_A          251 PTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDLTGI  330 (564)
T ss_dssp             SCCCTTCCTTCCHHHHCCHHHHCCBBCGGGGHHHHHHHHHHTTSCCTTCEEECTTSEEEETTEEEECSCCCCSEEEHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCEEEECCCCCEECCCCEEECCCCCCCCHHHHHH
T ss_conf             98664321246846777577618678863577899999997797256426752786253587102013234552021110


Q ss_pred             HHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCEECCCCCCCEEEHHHCCCCCCHH
Q ss_conf             55036712354320233332001101222576344686542111122--3355441001146875213001002211001
Q gi|254781103|r  382 FRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAAL  459 (598)
Q Consensus       382 l~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p--~~~~~~~~~~~~~Gqg~~~TPlqla~~~ati  459 (598)
                      |++|||++|+++++++|.+.+.+++++|||++++++|+|++..+..|  ..|.....+++++|||+.+||||||++|++|
T Consensus       331 l~~S~Nv~f~~l~~~lg~~~~~~~~~~fG~g~~~~id~p~~~~~~~~~~~~~~~~~~~~~~~Gqg~~vTPlqma~~~a~i  410 (564)
T 3oc2_A          331 LIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAAL  410 (564)
T ss_dssp             HHTTCHHHHHHHHHHHCHHHHHHHHHHTTTTSCCCCSCTTCCCCBCCCCSSCCHHHHHHHHTTCSCBBCHHHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             12166719999999875899999999779987779997422157777644322332002213887346799999988762


Q ss_pred             HHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHC-CCCEEECCCCCEEEEEECCEEEECCCC--CCCCCC
Q ss_conf             10782301089998630788503201899999999999998733-884641047973576672403512688--766886
Q gi|254781103|r  460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKK--RYSDTL  536 (598)
Q Consensus       460 AN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~-~GTg~~a~~~g~~vaGKTGTAq~~~~g--~y~~~~  536 (598)
                      ||+|.+++|++++...+..   ..+++|+++++.+++||+.||+ .||+.++.++||+|||||||||+...+  +|.++.
T Consensus       411 AN~G~~~~p~~~~~~~~~~---~~~vis~~~a~~v~~~l~~Vv~~~gt~~~a~~~g~~iAGKTGTAq~~~~~~~~~~~~~  487 (564)
T 3oc2_A          411 ANDGKSVPLSMTRVDRVPD---GVQVISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKGYRENA  487 (564)
T ss_dssp             HTTTEECCCBSBCCSSCCC---CEECSCHHHHHHHHHHHHHHHHSTTSCGGGCCTTSCCEEEEEEEEC-----------C
T ss_pred             CCCCEEEECEEEEEECCCC---CCCCCCHHHHHHHHHHHHHEEECCCCEEEECCCCCEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             2798796035787403664---3356898999999999974697899888642799679998623611558887622688


Q ss_pred             CEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             217999997428880999999807888888874321467899999999999981899855
Q gi|254781103|r  537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF  596 (598)
Q Consensus       537 ~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~~~i~P~~  596 (598)
                      +++||+||+|++||+|+|+|||++|+..   +.+||.+|||||++||++++++++|+|+.
T Consensus       488 ~~awFvGy~P~~~P~~av~V~v~~~~~~---g~~Gg~~AaPi~~~im~~~l~~~~v~p~~  544 (564)
T 3oc2_A          488 YRSLFAGFAPATDPRIAMVVVIDEPSKA---GYFGGLVSAPVFSKVMAGALRLMNVPPDN  544 (564)
T ss_dssp             EEEEEEEEECTTSCCEEEEEEEEEC--------CHHHHTHHHHHHHHHHHHHHTTCCCCC
T ss_pred             CEEEEEEEEECCCCEEEEEEEEECCCCC---CCCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             6699999987799859999999028988---87655999999999999999766989876



>3equ_A PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Back     alignment and structure
>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C* Back     alignment and structure
>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A Back     alignment and structure
>1vqq_A Saupbp2A, penicillin-binding protein MECA, low-affinity; beta-lactam, D- transpeptidase, D-carboxypeptidase, biosynthetic protein; 1.80A {Staphylococcus aureus} SCOP: d.17.4.5 d.175.1.1 e.3.1.1 PDB: 1mwr_A 1mws_A* 1mwt_A* 1mwu_A* Back     alignment and structure
>3lo7_A PBPA, penicillin-binding protein A; transpeptidase domain, cell membrane, cell shape, cell WALL biogenesis/degradation, membrane; 2.05A {Mycobacterium tuberculosis} Back     alignment and structure
>2v2f_F Penicillin binding protein 1A; transpeptidase activity, peptidoglycan synthesis, transferase, hydrolase; HET: MES; 1.9A {Streptococcus pneumoniae} PDB: 2zc6_B* 2zc5_B* 2c6w_B 2c5w_B* Back     alignment and structure
>3fwm_A Penicillin-binding protein 1B; bacterial cell WALL synthesis, antibiotics design, transferase, hydrolase; HET: M0E; 2.16A {Escherichia coli} PDB: 3fwl_A* Back     alignment and structure
>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A* Back     alignment and structure
>2jch_A Penicillin-binding protein 1B; peptidoglycan synthesis multifunctional enzyme, cell WALL, peptidoglycan, gamma lactam antibiotics; HET: PL7; 2.4A {Streptococcus pneumoniae} PDB: 2jci_A* 2je5_A* Back     alignment and structure
>1xkz_A Regulatory protein BLAR1; beta-lactam receptor, signal transduction, signaling protein; HET: CAZ EPE; 1.75A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1xa1_A* 1xa7_A* Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Back     alignment and structure
>2iwb_A Methicillin resistance MECR1 protein; antibiotic resistance, bacterial antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, MRSA; 1.8A {Staphylococcus aureus} PDB: 2iwc_A* 2iwd_A* Back     alignment and structure
>1k38_A Penicillinase, beta-lactamase OXA-2; serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine; HET: KCX; 1.50A {Salmonella typhimurium} SCOP: e.3.1.1 PDB: 3if6_A* Back     alignment and structure
>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A* Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioesterase, DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Back     alignment and structure