254781104

254781104

hypothetical protein CLIBASIA_05030

GeneID in NCBI database:8210129Locus tag:CLIBASIA_05030
Protein GI in NCBI database:254781104Protein Accession:YP_003065517.1
Gene range:-(1105000, 1105377)Protein Length:125aa
Gene description:hypothetical protein
COG prediction:[S] Predicted secreted (periplasmic) protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccEEccHHHHccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccEEEEEHHHccccHHHHHHHHHHHHHHccccccccHEEcHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLqatnpinlityDDLARLkkhtllpenrsnlpkrTVERRQHRKEIVQQQ
MFKTLDFIILGVVLASITITysikhetegkkekLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQlqatnpinliTYDDLARLKKhtllpenrsnlpkrtverrqhrkeivqqq
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYD************************************
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIV***
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKTLDFIILGVVLASITITYSIKHETEGKKEKxxxxxxxxxxxxxxxxxxxxxWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ
MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEIVQQQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target125 hypothetical protein CLIBASIA_05030 [Candidatus Liberib
315122412124 hypothetical protein CKC_03320 [Candidatus Liberibacter 1 7e-36
209550181157 hypothetical protein Rleg2_2601 [Rhizobium leguminosaru 1 1e-16
325293472186 hypothetical protein AGROH133_07458 [Agrobacterium sp. 1 2e-16
86358457156 hypothetical protein RHE_CH02854 [Rhizobium etli CFN 42 1 2e-16
218508690125 hypothetical protein RetlB5_14561 [Rhizobium etli Brasi 1 3e-16
218461399158 hypothetical protein RetlK5_18702 [Rhizobium etli Kim 5 1 4e-16
327194629160 hypothetical protein RHECNPAF_1140040 [Rhizobium etli C 1 4e-16
218517128156 hypothetical protein Retl8_28078 [Rhizobium etli 8C-3] 1 9e-16
190892590152 hypothetical protein RHECIAT_CH0003005 [Rhizobium etli 1 1e-15
159185047188 hypothetical protein Atu2101 [Agrobacterium tumefaciens 1 1e-15
>gi|315122412|ref|YP_004062901.1| hypothetical protein CKC_03320 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124 Back     alignment and organism information
 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%)

Query: 1   MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ 60
           M K  D  ++ +VL SIT+TYSIK +TE K+E LR LE+KI  EQ+YIDLLKAQWALL+Q
Sbjct: 1   MLKNFDLFMIVIVLVSITMTYSIKQQTENKRELLRSLESKILLEQDYIDLLKAQWALLVQ 60

Query: 61  PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKE 120
           PD IKDLV  YQKELQLQ TNP+NLI+YDDL++LK+   L ENR NLPK  ++   ++K+
Sbjct: 61  PDHIKDLVIFYQKELQLQPTNPVNLISYDDLSKLKRRFFLNENRFNLPKNKLKNVPYQKK 120

Query: 121 IVQQ 124
           I+ +
Sbjct: 121 IIHK 124


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550181|ref|YP_002282098.1| hypothetical protein Rleg2_2601 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 157 Back     alignment and organism information
>gi|325293472|ref|YP_004279336.1| hypothetical protein AGROH133_07458 [Agrobacterium sp. H13-3] Length = 186 Back     alignment and organism information
>gi|86358457|ref|YP_470349.1| hypothetical protein RHE_CH02854 [Rhizobium etli CFN 42] Length = 156 Back     alignment and organism information
>gi|218508690|ref|ZP_03506568.1| hypothetical protein RetlB5_14561 [Rhizobium etli Brasil 5] Length = 125 Back     alignment and organism information
>gi|218461399|ref|ZP_03501490.1| hypothetical protein RetlK5_18702 [Rhizobium etli Kim 5] Length = 158 Back     alignment and organism information
>gi|327194629|gb|EGE61479.1| hypothetical protein RHECNPAF_1140040 [Rhizobium etli CNPAF512] Length = 160 Back     alignment and organism information
>gi|218517128|ref|ZP_03513968.1| hypothetical protein Retl8_28078 [Rhizobium etli 8C-3] Length = 156 Back     alignment and organism information
>gi|190892590|ref|YP_001979132.1| hypothetical protein RHECIAT_CH0003005 [Rhizobium etli CIAT 652] Length = 152 Back     alignment and organism information
>gi|159185047|ref|NP_355066.2| hypothetical protein Atu2101 [Agrobacterium tumefaciens str. C58] Length = 188 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target125 hypothetical protein CLIBASIA_05030 [Candidatus Liberib
COG5462138 COG5462, COG5462, Predicted secreted (periplasmic) prot 8e-19
>gnl|CDD|35021 COG5462, COG5462, Predicted secreted (periplasmic) protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 125 hypothetical protein CLIBASIA_05030 [Candidatus Liberib
COG5462138 Predicted secreted (periplasmic) protein [Function unkn 99.9
TIGR0220985 ftsL_broad cell division protein FtsL; InterPro: IPR011 98.75
pfam0499997 FtsL Cell division protein FtsL. In Escherichia coli, n 98.36
COG4839120 FtsL Protein required for the initiation of cell divisi 97.83
PRK10772121 cell division protein FtsL; Provisional 97.75
COG3116105 FtsL Cell division protein [Cell division and chromosom 97.38
PRK00888105 ftsB cell division protein FtsB; Reviewed 96.59
pfam0497780 DivIC Septum formation initiator. DivIC from B. subtili 96.29
pfam12097 375 DUF3573 Protein of unknown function (DUF3573). This fam 93.98
>COG5462 Predicted secreted (periplasmic) protein [Function unknown] Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL; InterPro: IPR011922 This entry represents FtsL, both forms similar to that in Escherichia coli and similar to that in Bacillus subtilis Back     alignment and domain information
>pfam04999 FtsL Cell division protein FtsL Back     alignment and domain information
>COG4839 FtsL Protein required for the initiation of cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10772 cell division protein FtsL; Provisional Back     alignment and domain information
>COG3116 FtsL Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>pfam04977 DivIC Septum formation initiator Back     alignment and domain information
>pfam12097 DUF3573 Protein of unknown function (DUF3573) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00