255764511

255764511

S-adenosyl-methyltransferase MraW

GeneID in NCBI database:8210130Locus tag:CLIBASIA_05035
Protein GI in NCBI database:255764511Protein Accession:YP_003065518.2
Gene range:-(1105379, 1106404)Protein Length:341aa
Gene description:S-adenosyl-methyltransferase MraW
COG prediction:[M] Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis
KEGG prediction:mraW; S-adenosyl-methyltransferase MraW (EC:2.1.1.-); K03438 S-adenosyl-methyltransferase [EC:2.1.1.-]
SEED prediction:rRNA small subunit methyltransferase H
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG
cccHHHHHHHccccccccccccccHHHHHHHHccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHccccccccccccccccccHHHHcccccccccHHHHHHcccHHHHHHHHHHHHccccccccHHccccccccHHHHcc
ccccccccccHcccccccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHccccccHHHHHEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccccccccccccHcccHHHHEEccccccccHHHHHHccccHHHHHHHHHHHccccccccccccccccHHHHHccc
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALlnpapgkvildatfgaggysrsfckmgsnvialdrdpfavscgqeTMRDYKEQFSLFQATFSQLqdyvpdkgvdgvVFDLGvssmqidcgdrgfsfqksgpldmrmscsgisasdvvnqANVKDLTRILGILGEEKQASRIAHAIVKrrqsapfqttqDLSSLIQKTvyfsknnrihpatrSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVrhmipsnahpavfQSITkkvvvptqedvafnrRSRSAKLRAGMRTVErsieddsfvhlprlptlsqfrg
meskscktMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKrrqsapfqttqdlSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKvvvptqedvafnrrsrsaklragmrtversieddsfvhlprlptlsqfrg
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG
*********************PVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFS****IHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFA**************SNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVER*********LPRLPTL*****
***********AIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG
****SCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG
MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
315122411348 S-adenosyl-methyltransferase MraW [Candidatus Liberibac 1 1e-153
159185048341 S-adenosyl-methyltransferase MraW [Agrobacterium tumefa 1 4e-99
325293473341 S-adenosyl-methyltransferase MraW [Agrobacterium sp. H1 1 5e-99
227822659341 S-adenosyl-methyltransferase MraW [Sinorhizobium fredii 1 3e-98
15965937341 S-adenosyl-methyltransferase MraW [Sinorhizobium melilo 1 5e-98
222086453341 S-adenosyl-methyltransferase protein [Agrobacterium rad 1 1e-97
86358458341 S-adenosyl-methyltransferase MraW [Rhizobium etli CFN 4 1 4e-97
116253056341 S-adenosyl-methyltransferase MraW [Rhizobium leguminosa 1 2e-96
222149144341 S-adenosyl-methyltransferase MraW [Agrobacterium vitis 1 3e-96
190892591341 S-adenosyl-methyltransferase [Rhizobium etli CIAT 652] 1 2e-95
>gi|315122411|ref|YP_004062900.1| S-adenosyl-methyltransferase MraW [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
 Score =  544 bits (1401), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/342 (77%), Positives = 298/342 (87%), Gaps = 1/342 (0%)

Query: 1   MESKSCKTMSSAIHHTIGDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSN 60
           M+S+  K  SS I  T   H+PVLLE+VIALL P+PGK+I+DATFGAGGYS SFC+MGS+
Sbjct: 1   MKSRYLKETSSPIDSTTNGHIPVLLEEVIALLKPSPGKIIVDATFGAGGYSHSFCQMGSS 60

Query: 61  VIALDRDPFAVSCGQETMRDY-KEQFSLFQATFSQLQDYVPDKGVDGVVFDLGVSSMQID 119
           VIALDRDP AV+ GQE M+DY K++ SLF+ATFS+L+DYVPD GVDG+VFDLGVSSMQID
Sbjct: 61  VIALDRDPLAVAAGQEIMKDYIKKKISLFEATFSRLKDYVPDNGVDGIVFDLGVSSMQID 120

Query: 120 CGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKR 179
           CGDRGFSFQK GPLDMRMSCSG+SASDVVN A+VKDL RILGILGEEKQASRIAHAIVKR
Sbjct: 121 CGDRGFSFQKHGPLDMRMSCSGVSASDVVNHADVKDLIRILGILGEEKQASRIAHAIVKR 180

Query: 180 RQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKAL 239
           R+  PFQTT+DLSSLIQ TVY   NNRIHPATRSFQALRIFVN+EI EL +GL SAEKAL
Sbjct: 181 RKHLPFQTTEDLSSLIQNTVYIRNNNRIHPATRSFQALRIFVNDEIRELEKGLLSAEKAL 240

Query: 240 KAGGLLIVVSFHSLEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQED 299
           K GG+LIVVSFHSLEDRLVKKFFASRSGKV AVRHMIPS+ HPAVFQS+TKKVV+PTQ D
Sbjct: 241 KDGGVLIVVSFHSLEDRLVKKFFASRSGKVTAVRHMIPSHIHPAVFQSLTKKVVIPTQSD 300

Query: 300 VAFNRRSRSAKLRAGMRTVERSIEDDSFVHLPRLPTLSQFRG 341
           +A NRR+RSAKLR G+RT  + ++D SF +L  LP LSQFRG
Sbjct: 301 IAKNRRARSAKLRVGIRTSAQPMKDLSFEYLAHLPALSQFRG 342


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159185048|ref|NP_355067.2| S-adenosyl-methyltransferase MraW [Agrobacterium tumefaciens str. C58] Length = 341 Back     alignment and organism information
>gi|325293473|ref|YP_004279337.1| S-adenosyl-methyltransferase MraW [Agrobacterium sp. H13-3] Length = 341 Back     alignment and organism information
>gi|227822659|ref|YP_002826631.1| S-adenosyl-methyltransferase MraW [Sinorhizobium fredii NGR234] Length = 341 Back     alignment and organism information
>gi|15965937|ref|NP_386290.1| S-adenosyl-methyltransferase MraW [Sinorhizobium meliloti 1021] Length = 341 Back     alignment and organism information
>gi|222086453|ref|YP_002544986.1| S-adenosyl-methyltransferase protein [Agrobacterium radiobacter K84] Length = 341 Back     alignment and organism information
>gi|86358458|ref|YP_470350.1| S-adenosyl-methyltransferase MraW [Rhizobium etli CFN 42] Length = 341 Back     alignment and organism information
>gi|116253056|ref|YP_768894.1| S-adenosyl-methyltransferase MraW [Rhizobium leguminosarum bv. viciae 3841] Length = 341 Back     alignment and organism information
>gi|222149144|ref|YP_002550101.1| S-adenosyl-methyltransferase MraW [Agrobacterium vitis S4] Length = 341 Back     alignment and organism information
>gi|190892591|ref|YP_001979133.1| S-adenosyl-methyltransferase [Rhizobium etli CIAT 652] Length = 341 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
PRK00050296 PRK00050, PRK00050, 16S rRNA m(4)C1402 methyltranserfas 1e-111
pfam01795310 pfam01795, Methyltransf_5, MraW methylase family 5e-85
TIGR00006305 TIGR00006, TIGR00006, S-adenosyl-methyltransferase MraW 7e-81
COG0275314 COG0275, COG0275, Predicted S-adenosylmethionine-depend 9e-97
KOG2782303 KOG2782, KOG2782, KOG2782, Putative SAM dependent methy 2e-47
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases related 0.003
>gnl|CDD|178824 PRK00050, PRK00050, 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>gnl|CDD|110769 pfam01795, Methyltransf_5, MraW methylase family Back     alignment and domain information
>gnl|CDD|161660 TIGR00006, TIGR00006, S-adenosyl-methyltransferase MraW Back     alignment and domain information
>gnl|CDD|30623 COG0275, COG0275, Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|37993 KOG2782, KOG2782, KOG2782, Putative SAM dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
TIGR00006323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 100.0
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 100.0
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 100.0
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 100.0
KOG2782303 consensus 100.0
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 96.31
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 96.12
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 95.96
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 95.86
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 95.43
KOG2899288 consensus 90.19
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 98.4
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.36
KOG2904328 consensus 91.73
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.31
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 97.27
PRK08317241 hypothetical protein; Provisional 98.07
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 97.78
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 97.68
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 97.59
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 97.59
PRK07402196 precorrin-6B methylase; Provisional 97.53
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 97.51
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 97.5
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 97.4
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 97.38
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.32
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 97.26
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 97.25
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 97.22
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 97.2
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 97.15
PRK11036256 putative metallothionein SmtA; Provisional 97.14
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 97.09
KOG2915314 consensus 97.04
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 97.02
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 96.66
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 96.62
pfam05175170 MTS Methyltransferase small domain. This domain is foun 96.59
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 96.48
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.4
PRK11933471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 96.37
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 96.37
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 96.35
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 96.07
PRK11207198 tellurite resistance protein TehB; Provisional 96.03
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 95.95
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 95.93
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 95.92
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 95.9
COG2520341 Predicted methyltransferase [General function predictio 95.88
COG4122219 Predicted O-methyltransferase [General function predict 95.83
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 95.82
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 95.82
COG1041347 Predicted DNA modification methylase [DNA replication, 95.79
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 95.78
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.77
KOG0820315 consensus 95.66
PTZ00338296 dimethyladenosine transferase; Provisional 95.61
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 95.55
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 95.51
COG4123248 Predicted O-methyltransferase [General function predict 95.44
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 95.38
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 95.34
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 95.3
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 95.2
PRK10742250 putative methyltransferase; Provisional 95.1
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 94.86
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 94.72
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 94.14
COG2521287 Predicted archaeal methyltransferase [General function 93.92
PRK04457262 spermidine synthase; Provisional 93.49
PRK00811283 spermidine synthase; Provisional 93.42
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 93.4
KOG3420185 consensus 92.68
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 92.5
KOG2360413 consensus 92.4
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 91.93
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 91.9
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 91.77
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 90.9
PRK03612516 spermidine synthase; Provisional 90.06
KOG2730263 consensus 97.72
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 97.37
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 97.27
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 97.24
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 97.19
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.94
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 96.64
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 96.14
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 95.83
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 95.77
pfam03848192 TehB Tellurite resistance protein TehB. 95.62
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 94.57
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 94.35
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 94.2
PRK06202233 hypothetical protein; Provisional 93.52
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 92.04
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 90.52
PRK12335289 tellurite resistance protein TehB; Provisional 90.3
PRK10901428 16S rRNA methyltransferase B; Provisional 97.63
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 93.79
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 93.48
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 93.22
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.03
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 90.93
PRK11524284 putative methyltransferase; Provisional 95.77
PRK13699227 putative methylase; Provisional 95.6
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 92.75
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 91.82
TIGR0042670 TIGR00426 competence protein ComEA helix-hairpin-helix 91.76
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 90.75
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 90.54
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2782 consensus Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>pfam06962 rRNA_methylase Putative rRNA methylase Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam04445 DUF548 Protein of unknown function (DUF548) Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>KOG2360 consensus Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG2730 consensus Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>TIGR00426 TIGR00426 competence protein ComEA helix-hairpin-helix repeat region; InterPro: IPR004509 This domain is found in competence protein ComEA and closely related proteins from a number of species that exhibit competence for transformation by exongenous DNA, including Streptococcus pneumoniae, Bacillus subtilis, Neisseria meningitidis, and Haemophilus influenzae Back     alignment and domain information
>pfam06962 rRNA_methylase Putative rRNA methylase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
1wg8_A285 Crystal Structure Of A Predicted S-Adenosylmethioni 4e-62
1m6y_A301 Crystal Structure Analysis Of Tm0872, A Putative Sa 7e-51
gi|56966831|pdb|1WG8|A Chain A, Crystal Structure Of A Predicted S-Adenosylmethionine- Dependent Methyltransferase Tt1512 From Thermus Thermophilus Hb8. Length = 285 Back     alignment and structure
 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 125/301 (41%), Positives = 181/301 (60%), Gaps = 26/301 (8%)

Query: 19  DHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETM 78
            HVPVL ++ + LL   PG V +DAT G  G++R   + G  VI LD+DP AV+  +   
Sbjct: 5   THVPVLYQEALDLLAVRPGGVYVDATLGGAGHARGILERGGRVIGLDQDPEAVARAKGL- 63

Query: 79  RDYKEQFSLFQATFSQLQDYVPD---KGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDM 135
             +    ++ Q  F  L+ ++     + VDG++ DLGVSS  +D   RGFS+QK GPLDM
Sbjct: 64  --HLPGLTVVQGNFRHLKRHLAALGVERVDGILADLGVSSFHLDDPSRGFSYQKEGPLDM 121

Query: 136 RMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAHAIVKRRQSAPFQTTQDLSSLI 195
           RM   G +A +VVN+  ++ L R+L  LGEE QA RIA AIV  R+ AP +TT  L+ ++
Sbjct: 122 RMGLEGPTAKEVVNRLPLEALARLLRELGEEPQAYRIARAIVAAREKAPIETTTQLAEIV 181

Query: 196 QKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLED 255
           +K V F +    HPA ++FQALRI+VN+E+  L + L  A + L  GG L+V++FHSLED
Sbjct: 182 RKAVGFRRAG--HPARKTFQALRIYVNDELNALKEFLEQAAEVLAPGGRLVVIAFHSLED 239

Query: 256 RLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGM 315
           R+VK+F                     +  + +TKK +VP++++ A N R+RSAKLRA  
Sbjct: 240 RVVKRFLRE------------------SGLKVLTKKPLVPSEKEAAQNPRARSAKLRAAE 281

Query: 316 R 316
           +
Sbjct: 282 K 282


>gi|28373611|pdb|1M6Y|A Chain A, Crystal Structure Analysis Of Tm0872, A Putative Sam- Dependent Methyltransferase, Complexed With Sah Length = 301 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent methyl 1e-72
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltransfer 2e-60
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 5e-07
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 7e-06
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 2e-04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 8e-04
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 0.001
1xxl_A239 YCGJ protein; structural genomics, protein structure in 0.001
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 0.001
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 0.003
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 0.003
3i9f_A170 Putative type 11 methyltransferase; structural genomics 0.004
1vl5_A260 Unknown conserved protein BH2331; 10174951, hypothetica 6e-06
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 5e-05
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 4e-04
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Length = 301 Back     alignment and structure
 Score =  268 bits (686), Expect = 1e-72
 Identities = 107/307 (34%), Positives = 170/307 (55%), Gaps = 25/307 (8%)

Query: 20  HVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSN--VIALDRDPFAVSCGQET 77
           H+PV++ +VI  L P   K+ILD T G GG+SR+  +      +I +D D   +   +E 
Sbjct: 10  HIPVMVREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCPGCRIIGIDVDSEVLRIAEEK 69

Query: 78  MRDYKEQFSLFQATFSQLQDYVPDKG---VDGVVFDLGVSSMQIDCGDRGFSFQKSGPLD 134
           ++++ ++ SLF+ ++ +    +   G   VDG++ DLGVS+ Q+   +RGF+F++  PLD
Sbjct: 70  LKEFSDRVSLFKVSYREADFLLKTLGIEKVDGILMDLGVSTYQLKGENRGFTFEREEPLD 129

Query: 135 MRMSCSGI-SASDVVNQANVKDLTRILGILGEEKQ-ASRIAHAIVKRRQSAPFQTTQDLS 192
           MRM      +A  V+N+   ++L RI+   GEEK+ A RIA  IV+ R            
Sbjct: 130 MRMDLESEVTAQKVLNELPEEELARIIFEYGEEKRFARRIARKIVENRPLNTTLDLVKAV 189

Query: 193 SLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHS 252
                  Y  +  + H AT++FQA+RI+VN E+E L + L+ AE  L  GG ++V+SFHS
Sbjct: 190 -REALPSYEIRRRKRHFATKTFQAIRIYVNRELENLKEFLKKAEDLLNPGGRIVVISFHS 248

Query: 253 LEDRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLR 312
           LEDR+VK+ F                  +    + +T+K V P++E++  N R+RS +LR
Sbjct: 249 LEDRIVKETF-----------------RNSKKLRILTEKPVRPSEEEIRENPRARSGRLR 291

Query: 313 AGMRTVE 319
           A  R  E
Sbjct: 292 AAERIEE 298


>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Length = 285 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Length = 185 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Length = 183 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransferase; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* Length = 381 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target341 S-adenosyl-methyltransferase MraW [Candidatus Liberibac
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltransfer 100.0
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent methyl 100.0
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 98.65
1vl5_A260 Unknown conserved protein BH2331; 10174951, hypothetica 98.62
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 98.61
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 98.43
2b25_A336 Hypothetical protein; structural genomics, methyl trans 98.41
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 98.35
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 98.29
3dtn_A234 Putative methyltransferase MM_2633; structural genomics 98.22
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 98.21
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 98.19
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 98.17
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 98.17
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 98.13
3ll7_A410 Putative methyltransferase; methytransferase, structura 98.13
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 98.13
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 98.06
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 97.98
1wzn_A252 SAM-dependent methyltransferase; structural genomics, r 97.98
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 97.96
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransferase, S 97.96
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 97.92
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoaspartyl 97.91
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 97.9
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 97.88
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 97.87
1xxl_A239 YCGJ protein; structural genomics, protein structure in 97.86
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossman-typ 97.84
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; HET: S 97.81
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; NP_34 97.79
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; methyt 97.78
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, rossmann 97.78
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 97.77
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxylating); 97.73
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 97.72
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 97.71
1ws6_A171 Methyltransferase; structural genomics, riken structura 97.7
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 97.69
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 97.67
3ege_A261 Putative methyltransferase from antibiotic biosynthesis 97.64
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- methy 97.63
3lpm_A259 Putative methyltransferase; structural genomics, protei 97.63
2o57_A297 Putative sarcosine dimethylglycine methyltransferase; s 97.63
2frn_A278 Hypothetical protein PH0793; structural genomics, PSI, 97.6
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 97.59
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltransfer 97.58
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed beta she 97.53
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protein; FM 97.53
1ve3_A227 Hypothetical protein PH0226; dimer, riken structural ge 97.51
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA domain, 97.49
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modifi 97.49
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, structura 97.44
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 97.43
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococcus h 97.39
3fpf_A298 Mtnas, putative uncharacterized protein; thermonicotian 97.39
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-adenosyl 97.37
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcytidin 97.35
3f4k_A257 Putative methyltransferase; structural genomics, PSI-2, 97.33
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 97.32
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 97.31
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 97.3
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; struc 97.3
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta- aspart 97.3
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, protein 97.29
3g5t_A299 Trans-aconitate 3-methyltransferase; structural genomic 97.28
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glycopepti 97.28
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 97.28
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 97.28
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structural ge 97.25
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 97.25
2i6g_A199 Putative methyltransferase; 16420133, structural genomi 97.24
1nw3_A416 Histone methyltransferase DOT1L; HDOT1, histone lysine 97.24
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase, str 97.2
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosylmeth 97.19
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, 97.19
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 97.18
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent methylt 97.14
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 97.14
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 97.14
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine modifi 97.11
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 97.1
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, structu 97.1
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messenger 97.02
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 97.02
3g5l_A253 Putative S-adenosylmethionine dependent methyltransfera 97.02
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 97.02
1xva_A292 Glycine N-methyltransferase; HET: SAM; 2.20A {Escherich 97.01
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, meth 97.0
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 97.0
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 96.97
2qm3_A373 Predicted methyltransferase; putative methyltransferase 96.96
3hvi_A221 Catechol O-methyltransferase; neurotransmitter degradat 96.91
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 96.91
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O- methyltransferas 96.89
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent meth 96.87
2p7i_A250 Hypothetical protein; putative methyltransferase, struc 96.86
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 96.86
3gru_A295 Dimethyladenosine transferase; rossman fold, ribosomal 96.85
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethionine-d 96.8
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, structur 96.78
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, SAH, S 96.76
3lcc_A235 Putative methyl chloride transferase; halide methyltran 96.74
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent meth 96.73
3ocj_A305 Putative exported protein; structural genomics, PSI-2, 96.72
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 96.72
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal RNA pr 96.69
3gu3_A284 Methyltransferase; alpha-beta protein, structural genom 96.67
2gpy_A233 O-methyltransferase; structural genomics, PSI, protein 96.67
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 96.63
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D 96.62
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 96.62
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, structura 96.62
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; antibiot 96.61
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena vari 96.59
2b3t_A276 Protein methyltransferase HEMK; translation termination 96.59
2b78_A385 Hypothetical protein SMU.776; structure genomics, methy 96.55
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 96.53
1zq9_A285 Probable dimethyladenosine transferase; SGC, structural 96.51
3c3p_A210 Methyltransferase; NP_951602.1, structural genomics, jo 96.5
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, tRNA m 96.47
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; protei 96.47
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modified ro 96.46
3kr9_A225 SAM-dependent methyltransferase; class I rossmann-like 96.46
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, structura 96.43
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeMet, b 96.43
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha/beta 96.43
3ou2_A218 SAM-dependent methyltransferase; O-methyltransferase, S 96.42
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 96.37
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 96.35
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 96.33
3frh_A253 16S rRNA methylase; methyltransferase domain, helical N 96.28
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 96.26
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; structu 96.22
1qyr_A252 KSGA, high level kasugamycin resistance protein, S-; ad 96.2
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 96.17
1x19_A359 CRTF-related protein; methyltransferase, bacteriochlloc 96.13
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipid syn 96.1
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann fold m 96.1
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 95.98
3p2e_A225 16S rRNA methylase; methyltransferase, transferase, NPM 95.88
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 95.86
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NMR {St 95.75
1xj5_A334 Spermidine synthase 1; structural genomics, protein str 95.61
2r3s_A335 Uncharacterized protein; methyltransferase domain, stru 95.6
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 95.58
2fyt_A340 Protein arginine N-methyltransferase 3; structural geno 95.52
1uir_A314 Polyamine aminopropyltransferase; spermidien synthase, 95.5
2okc_A445 Type I restriction enzyme stysji M protein; NP_813429.1 95.35
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-me 95.34
2h1r_A299 Dimethyladenosine transferase, putative; SGC toronto di 95.3
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransferase 95.15
2h00_A254 Methyltransferase 10 domain containing protein; structu 95.14
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabolism; 94.8
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, protei 94.61
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adeno 94.49
3bwc_A304 Spermidine synthase; SAM, SGPP, structural genomics, PS 94.47
2pt6_A321 Spermidine synthase; transferase, structural genomics c 94.45
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fold; HE 94.37
2ip2_A334 Probable phenazine-specific methyltransferase; pyocyani 94.36
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50A {Ca 94.34
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like fold 94.3
3gjy_A317 Spermidine synthase; APC62791, structural genomics, PSI 94.22
2i7c_A283 Spermidine synthase; transferase, structural genomics c 94.16
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 94.01
1or8_A340 Protein arginine N-methyltransferase 1; protein arginin 93.94
2avd_A229 Catechol-O-methyltransferase; structural genomics, stru 93.93
1vlm_A219 SAM-dependent methyltransferase; possible histamine N-m 93.79
1mjf_A281 Spermidine synthase; spermidine synthetase, structural 93.77
2qe6_A274 Uncharacterized protein TFU_2867; putative methyltransf 93.71
2o07_A304 Spermidine synthase; structural genomics, structural ge 93.55
3opn_A232 Putative hemolysin; structural genomics, PSI-2, protein 93.41
1iy9_A275 Spermidine synthase; rossmann fold, structural genomics 93.36
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding domain, 93.25
2aot_A292 HMT, histamine N-methyltransferase; classic methyltrans 93.01
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, structu 92.99
3duw_A223 OMT, O-methyltransferase, putative; alternating of alph 92.88
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methionine, h 92.78
3b3j_A480 Histone-arginine methyltransferase CARM1; protein argin 92.67
1i4w_A353 Mitochondrial replication protein MTF1; mitochondrial t 92.53
3b3f_A341 Histone-arginine methyltransferase CARM1; protein argin 92.52
3adn_A294 Spermidine synthase; aminopropyltransferase, polyamine 92.49
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, 91.57
2hnk_A239 SAM-dependent O-methyltransferase; modified rossman fol 91.22
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein; str 90.52
3fut_A271 Dimethyladenosine transferase; methyltransferase, dimet 90.14
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 98.07
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, meth 95.51
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmethionin 95.44
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracycline 95.03
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 94.22
3dp7_A363 SAM-dependent methyltransferase; structural genomics, p 93.58
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-adenosy 97.16
3e8s_A227 Putative SAM dependent methyltransferase; NP_744700.1, 96.95
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 96.93
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleotidyltr 96.66
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 specif 96.58
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 96.58
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative spli 96.48
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, methyltra 96.47
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopurine me 96.2
3i9f_A170 Putative type 11 methyltransferase; structural genomics 96.19
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protein, st 95.93
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyclic a 95.75
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; metal 95.28
3cc8_A230 Putative methyltransferase; NP_977653.1, structural gen 95.01
3g07_A292 7SK snRNA methylphosphate capping enzyme; structural ge 94.79
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, structur 94.74
2i62_A265 Nicotinamide N-methyltransferase; structural genomics, 92.76
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-RNA co 90.46
1boo_A323 Protein (N-4 cytosine-specific methyltransferase PVU II 96.2
2zig_A297 TTHA0409, putative modification methylase; methyltransf 95.92
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
Probab=100.00  E-value=0  Score=784.44  Aligned_cols=278  Identities=45%  Similarity=0.706  Sum_probs=264.5

Q ss_pred             CCCCCCHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHCCEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHH
Q ss_conf             78334009868866083888889983768828899999748909998099899999999852148852771132788987
Q gi|255764511|r   18 GDHVPVLLEKVIALLNPAPGKVILDATFGAGGYSRSFCKMGSNVIALDRDPFAVSCGQETMRDYKEQFSLFQATFSQLQD   97 (341)
Q Consensus        18 ~~H~PVll~Evl~~l~~~~~g~~iD~TlG~GGHS~~iL~~~~~liaiDrD~~ai~~a~~~l~~~~~r~~~~~~~F~~i~~   97 (341)
                      ..|+|||++||+++|.++++|+|||||||+||||++||+++++|||||+||+|+..|+++   +.+++.+++.+|+++.+
T Consensus         4 ~~H~PVLl~Evl~~L~~~~~g~~iD~T~G~GGHS~~iL~~~~~liaiDrD~~Ai~~a~~~---~~~~~~~~~~~f~~~~~   80 (285)
T 1wg8_A            4 MTHVPVLYQEALDLLAVRPGGVYVDATLGGAGHARGILERGGRVIGLDQDPEAVARAKGL---HLPGLTVVQGNFRHLKR   80 (285)
T ss_dssp             CCCCCTTHHHHHHHHTCCTTCEEEETTCTTSHHHHHHHHTTCEEEEEESCHHHHHHHHHT---CCTTEEEEESCGGGHHH
T ss_pred             CCCCCCCHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHC---CCCCCEEEEEEHHHHHH
T ss_conf             986762199999727858999999948898299999995799389998988999986640---44431688630012178


Q ss_pred             HHHH---CCCCEEEEECCCHHHHHHHHHHCCCCCCCCCEECCCCCCCCCHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             6531---2332478622520788876540734456641010435568418999862225789989997446302688999
Q gi|255764511|r   98 YVPD---KGVDGVVFDLGVSSMQIDCGDRGFSFQKSGPLDMRMSCSGISASDVVNQANVKDLTRILGILGEEKQASRIAH  174 (341)
Q Consensus        98 ~l~~---~~vdgIl~DLGvSS~Qld~~~RGFSf~~dgpLDMRmd~~~~tA~eiln~~s~~~L~~i~~~yGee~~a~~IA~  174 (341)
                      ++..   .+|||||+||||||+|||+++|||||+.|||||||||+++.+|+||||+|++++|++||++||||++|++||+
T Consensus        81 ~l~~~~~~~vdgIL~DLGvSS~QlD~~~RGFSF~~dgpLDMRMd~~~~~A~~iln~~~e~~L~~i~~~yGEe~~a~~IA~  160 (285)
T 1wg8_A           81 HLAALGVERVDGILADLGVSSFHLDDPSRGFSYQKEGPLDMRMGLEGPTAKEVVNRLPLEALARLLRELGEEPQAYRIAR  160 (285)
T ss_dssp             HHHHTTCSCEEEEEEECSCCHHHHHCGGGCCCSSSCCBSCCCSSSCSCCHHHHHHHSCHHHHHHHHHHHHCCTTHHHHHH
T ss_pred             HHHHCCCCCCCEEEEECCCCHHHHCCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             89864976577899705658275547755761267786776530148779999985408999999999467358899999


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCH
Q ss_conf             99999752124321379999998876431277125788888876651340578999999885202445338998725502
Q gi|255764511|r  175 AIVKRRQSAPFQTTQDLSSLIQKTVYFSKNNRIHPATRSFQALRIFVNNEIEELAQGLRSAEKALKAGGLLIVVSFHSLE  254 (341)
Q Consensus       175 ~Iv~~R~~~~i~TT~eL~~iI~~~~~~~~~~k~hpatr~FQALRI~VN~El~~L~~~L~~~~~~L~~gGrl~VISFHSLE  254 (341)
                      +||++|+.++|.||.+|+++|..+++.  +.++||||||||||||+||+||++|+.+|.+++++|+||||||||||||||
T Consensus       161 ~Iv~~R~~~~~~tt~~L~~~i~~~~~~--~~~~~patr~FQALRI~VN~EL~~L~~~L~~~~~~L~~gGrl~VISFHSLE  238 (285)
T 1wg8_A          161 AIVAAREKAPIETTTQLAEIVRKAVGF--RRAGHPARKTFQALRIYVNDELNALKEFLEQAAEVLAPGGRLVVIAFHSLE  238 (285)
T ss_dssp             HHHHHHHHSCCCBHHHHHHHHHHHHCC--CSSSCTTHHHHHHHHHHHTTHHHHHHHHHHHHHHHEEEEEEEEEEECSHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHH--CCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHH
T ss_conf             999987437642048888888887641--357883677888888862761899999999999863679679999717289


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCHHHHHHCCCCCEEEEEEEEECC
Q ss_conf             3899999986417887776567787777540452486547888999828710012323778717
Q gi|255764511|r  255 DRLVKKFFASRSGKVMAVRHMIPSNAHPAVFQSITKKVVVPTQEDVAFNRRSRSAKLRAGMRTV  318 (341)
Q Consensus       255 DRiVK~ff~~~~~~~~~~~~~~~~~~~~~~~~~l~kkpi~PS~~Ei~~NpRSRSAKLRv~~k~~  318 (341)
                      |||||+||+.++                  |++++||||+||++||+.|||||||||||++|++
T Consensus       239 DRiVK~~fk~~~------------------~~~~~kkpi~ps~~Ei~~NpRsRSAkLRv~~k~~  284 (285)
T 1wg8_A          239 DRVVKRFLRESG------------------LKVLTKKPLVPSEKEAAQNPRARSAKLRAAEKEA  284 (285)
T ss_dssp             HHHHHHHHHHHC------------------SEESCSSCBCCCHHHHHHCGGGGGCEEEEEECCC
T ss_pred             HHHHHHHHHHCC------------------CCCCCCCCCCCCHHHHHHCCCCHHEEEEEEEEEC
T ss_conf             999999997365------------------2002599948899999758962510322899707



>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; 10174951, hypothetical protein, structural genomics, JCSG, protein structure initiative, PSI; HET: MSE; 1.95A {Bacillus halodurans c-125} SCOP: c.66.1.41 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics, protein structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)- methyltransferase [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, PSI, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomics, JCSG, PSI, protein structure initiative; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum dsm 1728} SCOP: c.66.1.13 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; NP_988299.1, structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.66.1.43 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus HB8} PDB: 2yr0_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase- like protein, methyltransferase domain; 1.85A {Lactobacillus casei atcc 334} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structural genomics; HET: SAH; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.66.1.32 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, structural genomics; 2.00A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase, structural genomics; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransferase posttranslational modification; 1.59A {Thermus thermophilus HB8} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosynthesis pathway; YP_324569.1, structural genomics; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly, inter-subunit disulfide bridge; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure