254781106

254781106

cell division protein MraZ

GeneID in NCBI database:8210131Locus tag:CLIBASIA_05040
Protein GI in NCBI database:254781106Protein Accession:YP_003065519.1
Gene range:-(1106425, 1106862)Protein Length:145aa
Gene description:cell division protein MraZ
COG prediction:none
KEGG prediction:mraZ; cell division protein MraZ; K03925 MraZ protein
SEED prediction:Cell division protein MraZ
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
cccccccccccccccccEEEcHHHHHHHHHccccEEEEEEccccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEEcccccEEccHHHHHHcccccEEEEEEEccEEEEccHHHHHHHHHHHHHHHHHHHHcc
ccccHccEEccccccccEEccHHHHHHHHHHccccEEEEcccccccEEEccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEcccccEEEccHHHHHHcccccEEEEEEcccEEEEccHHHHHHHHHHHHHHHHHHHHcc
msrflsnvtqkidskgrvsvpFVFRTILAQRCItdlycfqdfffpaisvgnsdLLEYFEQKIAeynpfsiqANQLSLLVHGGgiflkmdsegrILMTDFIRVFTGIenevtfvgrgnyfqlwnpqtfrKLQEESRNEYCRQLLQK
msrflsnvtqkidskgrvsvpFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFE*************NQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEES****C*Q****
**********KIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
*SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQ*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK
MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target145 cell division protein MraZ [Candidatus Liberibacter asi
315122410148 cell division protein MraZ [Candidatus Liberibacter sol 1 3e-64
218679273149 cell division protein MraZ [Rhizobium etli CIAT 894] Le 1 2e-50
222086452146 MraZ protein [Agrobacterium radiobacter K84] Length = 1 1 3e-49
15965938146 cell division protein MraZ [Sinorhizobium meliloti 1021 1 1e-47
222149145146 cell division protein MraZ [Agrobacterium vitis S4] Len 1 8e-47
17935988146 cell division protein MraZ [Agrobacterium tumefaciens s 1 1e-46
227822660146 cell division protein MraZ [Sinorhizobium fredii NGR234 1 2e-46
150397292146 cell division protein MraZ [Sinorhizobium medicae WSM41 1 2e-46
327191488145 cell division protein MraZ [Rhizobium etli CNPAF512] Le 1 4e-46
187671949145 RecName: Full=Protein MraZ Length = 145 1 4e-46
>gi|315122410|ref|YP_004062899.1| cell division protein MraZ [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 148 Back     alignment and organism information
 Score =  248 bits (632), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 117/145 (80%), Positives = 128/145 (88%)

Query: 1   MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQ 60
           +SRFLSN T+KIDSKGRVS+P  FRTIL +RCI DLYCFQDFFFP+ISVGNSD LE FE+
Sbjct: 4   VSRFLSNATKKIDSKGRVSIPSFFRTILTKRCICDLYCFQDFFFPSISVGNSDFLERFER 63

Query: 61  KIAEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQ 120
           KI EY+P SIQ NQLSLLVHGGG+FLKMDSEGRI+MTDFIR FTGIENEVTFVGRGNYFQ
Sbjct: 64  KIEEYDPLSIQYNQLSLLVHGGGVFLKMDSEGRIMMTDFIRSFTGIENEVTFVGRGNYFQ 123

Query: 121 LWNPQTFRKLQEESRNEYCRQLLQK 145
           LWNP TF+ LQE+ RNEYC Q  QK
Sbjct: 124 LWNPDTFKNLQEKYRNEYCLQFSQK 148


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218679273|ref|ZP_03527170.1| cell division protein MraZ [Rhizobium etli CIAT 894] Length = 149 Back     alignment and organism information
>gi|222086452|ref|YP_002544987.1| MraZ protein [Agrobacterium radiobacter K84] Length = 146 Back     alignment and organism information
>gi|15965938|ref|NP_386291.1| cell division protein MraZ [Sinorhizobium meliloti 1021] Length = 146 Back     alignment and organism information
>gi|222149145|ref|YP_002550102.1| cell division protein MraZ [Agrobacterium vitis S4] Length = 146 Back     alignment and organism information
>gi|17935988|ref|NP_532778.1| cell division protein MraZ [Agrobacterium tumefaciens str. C58] Length = 146 Back     alignment and organism information
>gi|227822660|ref|YP_002826632.1| cell division protein MraZ [Sinorhizobium fredii NGR234] Length = 146 Back     alignment and organism information
>gi|150397292|ref|YP_001327759.1| cell division protein MraZ [Sinorhizobium medicae WSM419] Length = 146 Back     alignment and organism information
>gi|327191488|gb|EGE58506.1| cell division protein MraZ [Rhizobium etli CNPAF512] Length = 145 Back     alignment and organism information
>gi|187671949|sp|Q1ME24|MRAZ_RHIL3 RecName: Full=Protein MraZ Length = 145 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target145 cell division protein MraZ [Candidatus Liberibacter asi
PRK00326139 PRK00326, PRK00326, cell division protein MraZ; Reviewe 5e-34
TIGR00242142 TIGR00242, TIGR00242, mraZ protein 1e-09
COG2001146 COG2001, COG2001, Uncharacterized protein conserved in 2e-26
pfam0238172 pfam02381, MraZ, MraZ protein 6e-05
>gnl|CDD|178978 PRK00326, PRK00326, cell division protein MraZ; Reviewed Back     alignment and domain information
>gnl|CDD|129345 TIGR00242, TIGR00242, mraZ protein Back     alignment and domain information
>gnl|CDD|32184 COG2001, COG2001, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|111290 pfam02381, MraZ, MraZ protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 145 cell division protein MraZ [Candidatus Liberibacter asi
PRK00326147 cell division protein MraZ; Reviewed 100.0
COG2001146 Uncharacterized protein conserved in bacteria [Function 100.0
TIGR00242152 TIGR00242 mraZ protein; InterPro: IPR003444 This family 99.9
pfam0238172 MraZ MraZ protein. This small 70 amino acid domain is f 99.56
COG2001146 Uncharacterized protein conserved in bacteria [Function 96.44
TIGR0143944 lp_hng_hel_AbrB transcriptional regulator, AbrB family; 95.55
PRK08577135 hypothetical protein; Provisional 94.78
pfam0238172 MraZ MraZ protein. This small 70 amino acid domain is f 99.47
PRK00326147 cell division protein MraZ; Reviewed 97.34
TIGR0143944 lp_hng_hel_AbrB transcriptional regulator, AbrB family; 94.43
COG200289 AbrB Regulators of stationary/sporulation gene expressi 93.86
COG200289 AbrB Regulators of stationary/sporulation gene expressi 94.33
>PRK00326 cell division protein MraZ; Reviewed Back     alignment and domain information
>COG2001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00242 TIGR00242 mraZ protein; InterPro: IPR003444 This family is characterised by a 70 amino acid region and is found duplicated in a group of bacterial proteins Back     alignment and domain information
>pfam02381 MraZ MraZ protein Back     alignment and domain information
>COG2001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01439 lp_hng_hel_AbrB transcriptional regulator, AbrB family; InterPro: IPR006339 This DNA-binding domain is found in proteins like AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>pfam02381 MraZ MraZ protein Back     alignment and domain information
>PRK00326 cell division protein MraZ; Reviewed Back     alignment and domain information
>TIGR01439 lp_hng_hel_AbrB transcriptional regulator, AbrB family; InterPro: IPR006339 This DNA-binding domain is found in proteins like AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR Back     alignment and domain information
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription] Back     alignment and domain information
>COG2002 AbrB Regulators of stationary/sporulation gene expression [Transcription] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target145 cell division protein MraZ [Candidatus Liberibacter asi
1n0e_A166 Crystal Structure Of A Cell Division And Cell Wall 2e-24
>gi|38492456|pdb|1N0E|A Chain A, Crystal Structure Of A Cell Division And Cell Wall Biosynthesis Protein Upf0040 From Mycoplasma Pneumoniae: Indication Of A Novel Fold With A Possible New Conserved Sequence Motif Length = 166 Back     alignment and structure
 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 20/143 (13%), Positives = 54/143 (37%), Gaps = 7/143 (4%)

Query: 3   RFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKI 62
             L      +D+K R+S+P   R                 F   + V      + + ++ 
Sbjct: 26  MLLGTFNITLDAKNRISLPAKLRA-----FFEGSIVINRGFENCLEVRKPQDFQKYFEQF 80

Query: 63  AEYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLW 122
             +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W
Sbjct: 81  NSFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIW 140

Query: 123 NPQTFRKLQEESRNEYCRQLLQK 145
           + + +      S +     + ++
Sbjct: 141 DKKLYEDYLANSES--LETVAER 161


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target145 cell division protein MraZ [Candidatus Liberibacter asi
1n0e_A166 Protein MRAZ; cell division and cell WALL biosynthesis 5e-23
>1n0e_A Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae} SCOP: b.129.1.2 PDB: 1n0f_A 1n0g_A Length = 166 Back     alignment and structure
 Score =  101 bits (254), Expect = 5e-23
 Identities = 20/133 (15%), Positives = 53/133 (39%), Gaps = 5/133 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L      +D+K R+S+P   R          +   + F    + V      + + ++  
Sbjct: 27  LLGTFNITLDAKNRISLPAKLRAFFEGS----IVINRGFE-NCLEVRKPQDFQKYFEQFN 81

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
            +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W+
Sbjct: 82  SFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWD 141

Query: 124 PQTFRKLQEESRN 136
            + +      S +
Sbjct: 142 KKLYEDYLANSES 154


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target145 cell division protein MraZ [Candidatus Liberibacter asi
1n0e_A166 Protein MRAZ; cell division and cell WALL biosynthesis 100.0
1n0e_A166 Protein MRAZ; cell division and cell WALL biosynthesis 96.96
2w1t_A 178 Spovt, stage V sporulation protein T; transcription, tr 91.03
2glw_A92 PHS018, 92AA long hypothetical protein; RIFT barrel, bi 95.43
1yfb_A59 Transition state regulatory protein ABRB; , homodimer, 94.4
1yfb_A59 Transition state regulatory protein ABRB; , homodimer, 93.78
2w1t_A178 Spovt, stage V sporulation protein T; transcription, tr 93.0
>1n0e_A Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae} SCOP: b.129.1.2 PDB: 1n0f_A 1n0g_A Back     alignment and structure
Probab=100.00  E-value=2.2e-43  Score=286.93  Aligned_cols=137  Identities=15%  Similarity=0.351  Sum_probs=124.8

Q ss_pred             CCCCCCCCCCEECCCCCEEECHHHHHHHHHCCCCCEEECCCCCCCEEECCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             96422211210567662710788999985248984995165664413045236789999986306887513799999863
Q gi|254781106|r    1 MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVH   80 (145)
Q Consensus         1 M~~F~G~~~~~lD~KGRi~iPa~fR~~L~~~~~~~lv~~~~~~~~~l~~~~~~~w~~~~~~i~~l~~~~~~~~~~~r~~~   80 (145)
                      +.||+|+|+|+||+||||+|||+||+.|.    ..+|+++++ ++||.+||.+.|+++++++++++.++++.+.+.|.++
T Consensus        24 ~~MF~G~~~~~lD~KGRlsiPa~fR~~L~----~~~vl~~~~-~~cL~~yp~~~w~~~~~~l~~l~~~~~~~r~l~r~l~   98 (166)
T 1n0e_A           24 GHMLLGTFNITLDAKNRISLPAKLRAFFE----GSIVINRGF-ENCLEVRKPQDFQKYFEQFNSFPSTQKDTRTLKRLIF   98 (166)
T ss_dssp             TSCBCSEEEECCCTTSEEECCSHHHHHCC----SEEECCCCT-TSCCEEBCHHHHHHHHHHHTTSCSSSHHHHHHHHHHH
T ss_pred             CCCEEECCCCCCCCCCCEEECHHHHHHHC----CEEEEECCC-CCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             54342334545768872575699998609----859996698-8876146998899999999845834188999999973


Q ss_pred             HHHHHCCCCCCCEEECCHHHHHHCCCCCEEEEEECCCEEEECCHHHHHHHHHHH--HHHHHHHH
Q ss_conf             111112217861475198999870998539999419989962989999999995--99999988
Q gi|254781106|r   81 GGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEES--RNEYCRQL  142 (145)
Q Consensus        81 ~~a~~~~~D~~GRi~ip~~lr~~agi~~ev~~vG~g~~fEIW~~~~~~~~~~~~--~~~~~~~l  142 (145)
                      ++|.++++|+||||+||+.||++|||+++|+|||+|++||||||++|+++.+++  .+++++.+
T Consensus        99 ~~a~~~~~D~qGRI~iP~~Lr~~AgL~~evv~vG~g~~fEIW~~~~we~~~~~~~~~~~lae~l  162 (166)
T 1n0e_A           99 ANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWDKKLYEDYLANSESLETVAERM  162 (166)
T ss_dssp             TTCCEEECCTTSEEECCHHHHHHTTCCSCEEEEECBSCEEEEEHHHHHHHHHSSCCHHHHHHTC
T ss_pred             CCCEEECCCCCCEEECCHHHHHHHCCCCEEEEEECCCEEEEECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6835813588834858999999849887099991799899928899999985344299998776



>1n0e_A Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae} SCOP: b.129.1.2 PDB: 1n0f_A 1n0g_A Back     alignment and structure
>2w1t_A Spovt, stage V sporulation protein T; transcription, transcription regulation, repressor, activator, DNA-binding; 2.60A {Bacillus subtilis} PDB: 2w1t_B 2ro5_A Back     alignment and structure
>2glw_A PHS018, 92AA long hypothetical protein; RIFT barrel, bioinformatics, transcription; NMR {Pyrococcus horikoshii OT3} Back     alignment and structure
>1yfb_A Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} SCOP: b.129.1.3 PDB: 1ysf_A 2k1n_A* 1z0r_A 2ro4_A 2fy9_A 2ro3_A Back     alignment and structure
>1yfb_A Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} SCOP: b.129.1.3 PDB: 1ysf_A 2k1n_A* 1z0r_A 2ro4_A 2fy9_A 2ro3_A Back     alignment and structure
>2w1t_A Spovt, stage V sporulation protein T; transcription, transcription regulation, repressor, activator, DNA-binding; 2.60A {Bacillus subtilis} PDB: 2w1t_B 2ro5_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 145 cell division protein MraZ [Candidatus Liberibacter asi
d1n0ea_141 b.129.1.2 (A:) Hypothetical protein MraZ {Mycoplasma pn 2e-20
>d1n0ea_ b.129.1.2 (A:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]} Length = 141 Back     information, alignment and structure

class: All beta proteins
fold: Double-split beta-barrel
superfamily: AbrB/MazE/MraZ-like
family: Hypothetical protein MraZ
domain: Hypothetical protein MraZ
species: Mycoplasma pneumoniae [TaxId: 2104]
 Score = 92.4 bits (229), Expect = 2e-20
 Identities = 20/133 (15%), Positives = 51/133 (38%), Gaps = 5/133 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L      +D+K R+S+P   R                 F   + V      + + ++  
Sbjct: 6   LLGTFNITLDAKNRISLPAKLRAFFEGS-----IVINRGFENCLEVRKPQDFQKYFEQFN 60

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
            +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W+
Sbjct: 61  SFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWD 120

Query: 124 PQTFRKLQEESRN 136
            + +      S +
Sbjct: 121 KKLYEDYLANSES 133


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target145 cell division protein MraZ [Candidatus Liberibacter asi
d1n0ea_141 Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId 100.0
d1n0ea_141 Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId 97.19
d1yfba151 Transcription-state regulator AbrB, the N-terminal DNA 93.93
d1yfba151 Transcription-state regulator AbrB, the N-terminal DNA 91.58
>d1n0ea_ b.129.1.2 (A:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
class: All beta proteins
fold: Double-split beta-barrel
superfamily: AbrB/MazE/MraZ-like
family: Hypothetical protein MraZ
domain: Hypothetical protein MraZ
species: Mycoplasma pneumoniae [TaxId: 2104]
Probab=100.00  E-value=1.2e-43  Score=287.10  Aligned_cols=138  Identities=14%  Similarity=0.346  Sum_probs=126.5

Q ss_pred             CCCCCCCCCCEECCCCCEEECHHHHHHHHHCCCCCEEECCCCCCCEEECCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             96422211210567662710788999985248984995165664413045236789999986306887513799999863
Q gi|254781106|r    1 MSRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVH   80 (145)
Q Consensus         1 M~~F~G~~~~~lD~KGRi~iPa~fR~~L~~~~~~~lv~~~~~~~~~l~~~~~~~w~~~~~~i~~l~~~~~~~~~~~r~~~   80 (145)
                      +.||+|+|.|+||+||||+|||+||+.|    .+.+|+++++ ++||++||.+.|+++++++++++.++++.+.+.|.++
T Consensus         3 ~~MF~G~~~~~lD~KGRlsiPa~fR~~l----~~~~vl~~~~-~~cL~~y~~~~~~~~~~~i~~l~~~~~~~r~~~r~l~   77 (141)
T d1n0ea_           3 GHMLLGTFNITLDAKNRISLPAKLRAFF----EGSIVINRGF-ENCLEVRKPQDFQKYFEQFNSFPSTQKDTRTLKRLIF   77 (141)
T ss_dssp             TSCBCSEEEECCCTTSEEECCSHHHHHC----CSEEECCCCT-TSCCEEBCHHHHHHHHHHHTTSCSSSHHHHHHHHHHH
T ss_pred             CCCEEEECCCCCCCCCCEEECHHHHHHH----CCCEEEECCC-CCCHHHCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             7215240333576777268519999873----8947996487-7841023898928998762135732288899999987


Q ss_pred             HHHHHCCCCCCCEEECCHHHHHHCCCCCEEEEEECCCEEEECCHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             11111221786147519899987099853999941998996298999999999599999988439
Q gi|254781106|r   81 GGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEESRNEYCRQLLQK  145 (145)
Q Consensus        81 ~~a~~~~~D~~GRi~ip~~lr~~agi~~ev~~vG~g~~fEIW~~~~~~~~~~~~~~~~~~~l~e~  145 (145)
                      ++|+++++|+||||+||+.||++|||+++|+|||+|++||||||++|+++.+++. + .++++|+
T Consensus        78 ~~a~~~~~D~~GRi~lp~~Lr~~a~l~~~vv~vG~g~~fEIW~~~~~~~~~~~~~-~-~~~laE~  140 (141)
T d1n0ea_          78 ANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWDKKLYEDYLANSE-S-LETVAER  140 (141)
T ss_dssp             TTCCEEECCTTSEEECCHHHHHHTTCCSCEEEEECBSCEEEEEHHHHHHHHHSSC-C-HHHHHHT
T ss_pred             HCCEEEEECCCCEEEECHHHHHHCCCCCCEEEEECCCEEEEECHHHHHHHHHHHH-H-HHHHHCC
T ss_conf             3150752256605960899998709998789994699999928899999986355-4-9987320



>d1n0ea_ b.129.1.2 (A:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1yfba1 b.129.1.3 (A:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yfba1 b.129.1.3 (A:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 145 cell division protein MraZ [Candidatus Liberibacte
1n0e_A_1-152152 (A:1-152) Protein MRAZ; cell division and cell WAL 2e-25
>1n0e_A (A:1-152) Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae}Length = 152 Back     alignment and structure
 Score =  109 bits (273), Expect = 2e-25
 Identities = 20/131 (15%), Positives = 52/131 (39%), Gaps = 5/131 (3%)

Query: 4   FLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIA 63
            L      +D+K R+S+P   R          +   + F    + V      + + ++  
Sbjct: 27  LLGTFNITLDAKNRISLPAKLRAFFEGS----IVINRGFE-NCLEVRKPQDFQKYFEQFN 81

Query: 64  EYNPFSIQANQLSLLVHGGGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWN 123
            +         L  L+     F+ +D+ GR+L+ + +     ++ E+  +G+ ++ ++W+
Sbjct: 82  SFPSTQKDTRTLKRLIFANANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWD 141

Query: 124 PQTFRKLQEES 134
            + +      S
Sbjct: 142 KKLYEDYLANS 152


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target145 cell division protein MraZ [Candidatus Liberibacter asi
1n0e_A_1-152152 Protein MRAZ; cell division and cell WALL biosynth 100.0
2glw_A_92 PHS018, 92AA long hypothetical protein; RIFT barre 94.4
1n0e_A_1-152152 Protein MRAZ; cell division and cell WALL biosynth 96.67
1yfb_A_59 Transition state regulatory protein ABRB; , homodi 92.03
1yfb_A_59 Transition state regulatory protein ABRB; , homodi 91.68
>1n0e_A (A:1-152) Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae} Back     alignment and structure
Probab=100.00  E-value=6.5e-42  Score=278.77  Aligned_cols=128  Identities=16%  Similarity=0.378  Sum_probs=122.2

Q ss_pred             CCCCCCCCCEECCCCCEEECHHHHHHHHHCCCCCEEECCCCCCCEEECCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             64222112105676627107889999852489849951656644130452367899999863068875137999998631
Q gi|254781106|r    2 SRFLSNVTQKIDSKGRVSVPFVFRTILAQRCITDLYCFQDFFFPAISVGNSDLLEYFEQKIAEYNPFSIQANQLSLLVHG   81 (145)
Q Consensus         2 ~~F~G~~~~~lD~KGRi~iPa~fR~~L~~~~~~~lv~~~~~~~~~l~~~~~~~w~~~~~~i~~l~~~~~~~~~~~r~~~~   81 (145)
                      +||+|+|+|+||+|||++|||+||++|.    .++|+++++ ++||++||+++|++++++|.+++..+++.+.+.|.+++
T Consensus        25 ~mF~G~~~~~lD~KGRl~iPa~fR~~L~----~~lvl~~~~-~~cL~~yp~~~w~~~~~ki~~l~~~~~~~r~l~r~~~~   99 (152)
T 1n0e_A           25 HMLLGTFNITLDAKNRISLPAKLRAFFE----GSIVINRGF-ENCLEVRKPQDFQKYFEQFNSFPSTQKDTRTLKRLIFA   99 (152)
T ss_dssp             SCBCSEEEECCCTTSEEECCSHHHHHCC----SEEECCCCT-TSCCEEBCHHHHHHHHHHHTTSCSSSHHHHHHHHHHHT
T ss_pred             CCEEECCCCCCCCCCCEEECHHHHHHHC----CEEEEECCC-CCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHC
T ss_conf             4332234546767872475699998609----869997799-88330159988999999998368324899999999845


Q ss_pred             HHHHCCCCCCCEEECCHHHHHHCCCCCEEEEEECCCEEEECCHHHHHHHHHHH
Q ss_conf             11112217861475198999870998539999419989962989999999995
Q gi|254781106|r   82 GGIFLKMDSEGRILMTDFIRVFTGIENEVTFVGRGNYFQLWNPQTFRKLQEES  134 (145)
Q Consensus        82 ~a~~~~~D~~GRi~ip~~lr~~agi~~ev~~vG~g~~fEIW~~~~~~~~~~~~  134 (145)
                      +++++++|+||||+||+.||++|||+++|+|||++++||||||++|+++++++
T Consensus       100 ~a~~v~lD~~GRi~iP~~Lr~~agl~~evv~vG~~~~~EIW~~e~~~~~~~ea  152 (152)
T 1n0e_A          100 NANFVDVDTAGRVLIPNNLINDAKLDKEIVLIGQFDHLEIWDKKLYEDYLANS  152 (152)
T ss_dssp             TCCEEECCTTSEEECCHHHHHHTTCCSCEEEEECBSCEEEEEHHHHHHHHHSS
T ss_pred             CCEEECCCCCCEEECCHHHHHHHCCCCEEEEEECCCEEEEECHHHHHHHHHHH
T ss_conf             85483227774374899999984999709999279989992878999998525



>2glw_A (A:) PHS018, 92AA long hypothetical protein; RIFT barrel, bioinformatics, transcription; NMR {Pyrococcus horikoshii OT3} Back     alignment and structure
>1n0e_A (A:1-152) Protein MRAZ; cell division and cell WALL biosynthesis protein, structural genomics, BSGC structure funded by NIH; 2.70A {Mycoplasma pneumoniae} Back     alignment and structure
>1yfb_A (A:) Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>1yfb_A (A:) Transition state regulatory protein ABRB; , homodimer, bioinformatics, swapped-hairpin barrel, transcription; NMR {Bacillus subtilis} Back     alignment and structure