254781107

254781107

phosphoglucomutase

GeneID in NCBI database:8210132Locus tag:CLIBASIA_05045
Protein GI in NCBI database:254781107Protein Accession:YP_003065520.1
Gene range:+(1107580, 1109208)Protein Length:542aa
Gene description:phosphoglucomutase
COG prediction:none
KEGG prediction:phosphoglucomutase (EC:5.4.2.2); K01835 phosphoglucomutase [EC:5.4.2.2]
SEED prediction:Phosphoglucomutase (EC 5.4.2.2)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Pentose phosphate pathway [PATH:las00030]
Galactose metabolism [PATH:las00052]
Starch and sucrose metabolism [PATH:las00500]
Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Purine metabolism [PATH:las00230]
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540--
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
cccccccccccccccccccccEEEccccccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHcccccEEEEEEccccccccccccEEEEccccccccHHHHHHHHHHHHHHcHHccccccccccccccccccccccEEEEccHHHHHHHHHHHccHHHHcHHHHcccEEEEEcccHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEccccEEEccHHHHHHHHHHHHcccccccccEEEEEEEcHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccEEEEEEcccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccc
ccEEEEEcccccccccEccEEEEEHHHHccccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEEEccccEccHHHHHHHHHHHHHccEEEEcccccccccccEEEEcccEEEEEEccHHHHHHHHHHHccHHHHHHHHcccccEEEEcccccHHHHHHHHHcccccccHHHEEcccccccHHHcccccHHHHHccccccccHHHcccEEEEccccccccEEEEccEEEcHHHHHHHHHHcHHHHHHccHccccEEEEcccccHHHHHHHHHcccEEEEccccHHHHHHHHcccccEEEEcccEEEEcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcEEEEEEEEEEEEEHHHHHHHHHHHHHHHHHccccccccEEEEEEEEccEEccccccEEccccEEEEEccccEEEEEEEEccccEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHcHHHHHccccccEEc
mlctivptvpyqdqkpgtsglrKKVSVFQQNSYTENFIQAIFNNVDCAEktlvvggdgrfynHIVIQKIIKIAAANGFARIIIgkggilstpAVSHLIRKYKASGGiiltashnpagatqdfgikyntssggsaseqQTEDIFEESKKITSYQiieandvdinhigtkELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGfrididcmnavtgpYAKEILErklgaptgsvrnfipledfggchpdpnlihakdLYDRmmmhdsadfgaacdgdgdrsmilgkgifvnpsdSLAIMVANAglipgyatGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMIticgeesfgtgsnhsrekdgIWSILFWLNILAVRGESLLDIVHKHWATygrnyysrydylgipteKAQDFMNDFRYRLKNLigssfigqkikqagdfvytdstngnvsdkqgIRVVFDNHSRIIYRisgtdtenstLRVYidnyepdsskhlkNTQEMLSDLVEVSQRISCLRhyightnpsias
mlctivptvpyqdqkpgtsglRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSsggsaseqqTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDstngnvsdkqgirVVFDNHSRIiyrisgtdtenstlRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLrhyightnpsias
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQkiikiaaaNGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHdsadfgaacdgdgdRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
***TIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEP******KNTQEMLSDLVEVSQRISCLRHYIGHTNPSI**
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNT*************IFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS
MLCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPIENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
254780544448 phosphoglucosamine mutase protein [Candidatus Libe 1e-15
>gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 448 Back     alignment
 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 99/367 (26%), Positives = 155/367 (42%), Gaps = 62/367 (16%)

Query: 17  GTSGLRKKVSVFQQNSYTENFIQAIFNNV------DCAEKTLVVGGDGRFYNHIVIQKII 70
           GT G+R K + F     T NF+  I   V          + +V+G D R   +++   ++
Sbjct: 7   GTDGIRGKSNTF---PITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63

Query: 71  KIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSS 130
               A G    I+G    + +PAV+ L R  +A  G++++ASHNP    QD GIK     
Sbjct: 64  AGFTAAGMDAFILGP---IPSPAVAMLTRSLRADVGVMISASHNP---YQDNGIKLFGPD 117

Query: 131 GGSAS---EQQTEDIFEESKKITSY-----QIIEANDVDINHIGTKELANMTISVIDPIE 182
           G   S   E + E + E+   +TSY      I  A  VD  H                 +
Sbjct: 118 GYKVSTDIEDRIETLLEDD--LTSYLSCYDSIGHAKRVDGVH-----------------D 158

Query: 183 NYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPT---GSVRNFI 239
            Y+  ++     D   +    G RI +DC N  +   A E+   +LGA     G   N I
Sbjct: 159 RYIEHVKRTLPRDVTLQ----GLRIVVDCANGASYKVAPEVFW-ELGADVVVIGDKPNGI 213

Query: 240 PLE-DFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILG-KGIFVNPSDSL 297
            +  D G      N++  +    R +    AD G A DGDGDR +I+  KG  VN  D +
Sbjct: 214 NINLDCGST----NVLSLQ----RKVHEVRADIGIALDGDGDRVIIVDEKGAIVN-GDQI 264

Query: 298 AIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMI 357
             ++A   +      G  G+  ++ ++  L+R    L L L  T  G ++    ++N   
Sbjct: 265 MALIAREWMSHSLLRG-NGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGF 323

Query: 358 TICGEES 364
            + GE+S
Sbjct: 324 NVGGEQS 330

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
315122472541 phosphoglucomutase [Candidatus Liberibacter solanacearu 1 0.0
150397941542 phosphoglucomutase [Sinorhizobium medicae WSM419] Lengt 1 0.0
15966600542 phosphoglucomutase [Sinorhizobium meliloti 1021] Length 1 0.0
227823422564 phosphoglucomutase [Sinorhizobium fredii NGR234] Length 1 0.0
86359187543 phosphoglucomutase [Rhizobium etli CFN 42] Length = 543 1 0.0
190893438543 phosphoglucomutase [Rhizobium etli CIAT 652] Length = 5 1 0.0
222087116542 phosphoglucomutase protein [Agrobacterium radiobacter K 1 0.0
116253855543 phosphoglucomutase [Rhizobium leguminosarum bv. viciae 1 0.0
209550927543 phosphoglucomutase [Rhizobium leguminosarum bv. trifoli 1 0.0
241206339543 phosphoglucomutase [Rhizobium leguminosarum bv. trifoli 1 0.0
>gi|315122472|ref|YP_004062961.1| phosphoglucomutase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 541 Back     alignment and organism information
 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/540 (80%), Positives = 491/540 (90%)

Query: 2   LCTIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEKTLVVGGDGRFY 61
           + T + T PY DQKPGTSGLRKKV VFQQN Y ENFIQ+IFN  +  +K L++GGDGRFY
Sbjct: 1   MYTTISTTPYLDQKPGTSGLRKKVVVFQQNCYVENFIQSIFNATNHTDKPLIIGGDGRFY 60

Query: 62  NHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQD 121
           N IVIQKII+IAAANGF+RIIIGKGGILSTPAVSH+IRKYKASGGIIL+ASHN AGATQD
Sbjct: 61  NRIVIQKIIRIAAANGFSRIIIGKGGILSTPAVSHIIRKYKASGGIILSASHNSAGATQD 120

Query: 122 FGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTKELANMTISVIDPI 181
           FGIKYNTS+GG ASEQ TE IFEESKKITSY+I+E+ D+DI+HI TKELANMTIS+I+P+
Sbjct: 121 FGIKYNTSNGGPASEQITEAIFEESKKITSYKIVESTDIDIDHISTKELANMTISIINPL 180

Query: 182 ENYVALMENIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILERKLGAPTGSVRNFIPL 241
           ++Y+ LME IFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILE KLGAP+GS+ NF+PL
Sbjct: 181 DDYIELMEKIFDFDAIRKLLSFGFRIDIDCMNAVTGPYAKEILEEKLGAPSGSICNFVPL 240

Query: 242 EDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIFVNPSDSLAIMV 301
           EDFGG HPDPNLIHAKDLYDRMM  DSADFGAACDGDGDR+MILGKGIFVNPSDSLAI+V
Sbjct: 241 EDFGGRHPDPNLIHAKDLYDRMMQDDSADFGAACDGDGDRNMILGKGIFVNPSDSLAIIV 300

Query: 302 ANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICG 361
           ANAGLIPGYA GLVGVARSMPTS ALDRVAEKL LKLFETPTGWKFF+NLLENG ITICG
Sbjct: 301 ANAGLIPGYAAGLVGVARSMPTSTALDRVAEKLELKLFETPTGWKFFSNLLENGAITICG 360

Query: 362 EESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRYDYLGIPT 421
           EESFGTGS+HSREKDG+WSILFWLNILAVRGESLLDIVHKHWATYGRNYYSR+DY  IPT
Sbjct: 361 EESFGTGSDHSREKDGLWSILFWLNILAVRGESLLDIVHKHWATYGRNYYSRHDYPNIPT 420

Query: 422 EKAQDFMNDFRYRLKNLIGSSFIGQKIKQAGDFVYTDSTNGNVSDKQGIRVVFDNHSRII 481
           + AQ+ + + R RLKNL G SF+G+KI++A DFVYTD  NGN+SDKQGIR++F++HSRII
Sbjct: 421 KNAQELIENIRLRLKNLAGKSFVGKKIEKADDFVYTDPFNGNISDKQGIRIIFEDHSRII 480

Query: 482 YRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIA 541
           YRISGTDT+NSTLR+YID+Y+P+S+++L+ TQ+ LS+L+E SQ+ISCLRHYIG  +P IA
Sbjct: 481 YRISGTDTDNSTLRIYIDSYQPNSAQYLEETQKTLSNLIEASQQISCLRHYIGERSPMIA 540


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397941|ref|YP_001328408.1| phosphoglucomutase [Sinorhizobium medicae WSM419] Length = 542 Back     alignment and organism information
>gi|15966600|ref|NP_386953.1| phosphoglucomutase [Sinorhizobium meliloti 1021] Length = 542 Back     alignment and organism information
>gi|227823422|ref|YP_002827395.1| phosphoglucomutase [Sinorhizobium fredii NGR234] Length = 564 Back     alignment and organism information
>gi|86359187|ref|YP_471079.1| phosphoglucomutase [Rhizobium etli CFN 42] Length = 543 Back     alignment and organism information
>gi|190893438|ref|YP_001979980.1| phosphoglucomutase [Rhizobium etli CIAT 652] Length = 543 Back     alignment and organism information
>gi|222087116|ref|YP_002545651.1| phosphoglucomutase protein [Agrobacterium radiobacter K84] Length = 542 Back     alignment and organism information
>gi|116253855|ref|YP_769693.1| phosphoglucomutase [Rhizobium leguminosarum bv. viciae 3841] Length = 543 Back     alignment and organism information
>gi|209550927|ref|YP_002282844.1| phosphoglucomutase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 543 Back     alignment and organism information
>gi|241206339|ref|YP_002977435.1| phosphoglucomutase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 543 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
KOG0625558 KOG0625, KOG0625, KOG0625, Phosphoglucomutase [Carbohyd 0.0
PLN02307579 PLN02307, PLN02307, phosphoglucomutase 0.0
PRK07564543 PRK07564, PRK07564, phosphoglucomutase; Validated 0.0
COG0033524 COG0033, Pgm, Phosphoglucomutase [Carbohydrate transpor 1e-149
COG1109464 COG1109, {ManB}, Phosphomannomutase [Carbohydrate trans 8e-46
cd05801522 cd05801, PGM_like3, This bacterial PGM-like (phosphoglu 3e-36
cd03087439 cd03087, PGM_like1, This archaeal PGM-like (phosphogluc 6e-23
KOG1220607 KOG1220, KOG1220, KOG1220, Phosphoglucomutase/phosphoma 2e-22
cd03085548 cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes th 0.0
cd05800461 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-l 4e-59
TIGR01132543 TIGR01132, pgm, phosphoglucomutase, alpha-D-glucose pho 1e-29
cd03084355 cd03084, phosphohexomutase, The alpha-D-phosphohexomuta 1e-52
cd05802434 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine m 6e-18
TIGR01455443 TIGR01455, glmM, phosphoglucosamine mutase 7e-16
PRK14314450 PRK14314, glmM, phosphoglucosamine mutase; Provisional 4e-14
PRK14323440 PRK14323, glmM, phosphoglucosamine mutase; Provisional 2e-13
cd05805441 cd05805, MPG1_transferase, GTP-mannose-1-phosphate guan 2e-07
pfam02878138 pfam02878, PGM_PMM_I, Phosphoglucomutase/phosphomannomu 2e-31
cd05799487 cd05799, PGM2, This CD includes PGM2 (phosphoglucomutas 8e-27
PTZ00150584 PTZ00150, PTZ00150, phosphoglucomutase-2-like protein; 5e-12
pfam02880111 pfam02880, PGM_PMM_III, Phosphoglucomutase/phosphomanno 2e-23
cd03089443 cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomu 3e-20
PRK14321449 PRK14321, glmM, phosphoglucosamine mutase; Provisional 2e-07
PRK15414456 PRK15414, PRK15414, phosphomannomutase CpsG; Provisiona 2e-05
PLN02371583 PLN02371, PLN02371, phosphoglucosamine mutase family pr 0.003
cd05803445 cd05803, PGM_like4, This PGM-like (phosphoglucomutase-l 1e-18
PRK14320443 PRK14320, glmM, phosphoglucosamine mutase; Provisional 3e-09
PRK14316448 PRK14316, glmM, phosphoglucosamine mutase; Provisional 2e-16
PRK14317465 PRK14317, glmM, phosphoglucosamine mutase; Provisional 1e-08
PRK10887443 PRK10887, glmM, phosphoglucosamine mutase; Provisional 1e-08
pfam02879103 pfam02879, PGM_PMM_II, Phosphoglucomutase/phosphomannom 3e-14
PRK14324446 PRK14324, glmM, phosphoglucosamine mutase; Provisional 2e-10
PRK14318448 PRK14318, glmM, phosphoglucosamine mutase; Provisional 3e-06
PRK14315448 PRK14315, glmM, phosphoglucosamine mutase; Provisional 2e-05
PRK14322429 PRK14322, glmM, phosphoglucosamine mutase; Provisional 6e-05
cd03088459 cd03088, ManB, ManB is a bacterial phosphomannomutase ( 6e-04
>gnl|CDD|35844 KOG0625, KOG0625, KOG0625, Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177942 PLN02307, PLN02307, phosphoglucomutase Back     alignment and domain information
>gnl|CDD|181032 PRK07564, PRK07564, phosphoglucomutase; Validated Back     alignment and domain information
>gnl|CDD|30382 COG0033, Pgm, Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31306 COG1109, {ManB}, Phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100094 cd05801, PGM_like3, This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>gnl|CDD|100089 cd03087, PGM_like1, This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>gnl|CDD|36434 KOG1220, KOG1220, KOG1220, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100087 cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|100093 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria Back     alignment and domain information
>gnl|CDD|130202 TIGR01132, pgm, phosphoglucomutase, alpha-D-glucose phosphate-specific Back     alignment and domain information
>gnl|CDD|100086 cd03084, phosphohexomutase, The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>gnl|CDD|100095 cd05802, GlmM, GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>gnl|CDD|130522 TIGR01455, glmM, phosphoglucosamine mutase Back     alignment and domain information
>gnl|CDD|184614 PRK14314, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184620 PRK14323, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|100097 cd05805, MPG1_transferase, GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity Back     alignment and domain information
>gnl|CDD|145827 pfam02878, PGM_PMM_I, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I Back     alignment and domain information
>gnl|CDD|100092 cd05799, PGM2, This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1) Back     alignment and domain information
>gnl|CDD|185482 PTZ00150, PTZ00150, phosphoglucomutase-2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|145829 pfam02880, PGM_PMM_III, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III Back     alignment and domain information
>gnl|CDD|100091 cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e Back     alignment and domain information
>gnl|CDD|172797 PRK14321, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|185312 PRK15414, PRK15414, phosphomannomutase CpsG; Provisional Back     alignment and domain information
>gnl|CDD|177999 PLN02371, PLN02371, phosphoglucosamine mutase family protein Back     alignment and domain information
>gnl|CDD|100096 cd05803, PGM_like4, This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|172796 PRK14320, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184616 PRK14316, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184617 PRK14317, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|182812 PRK10887, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|145828 pfam02879, PGM_PMM_II, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II Back     alignment and domain information
>gnl|CDD|184621 PRK14324, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184618 PRK14318, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184615 PRK14315, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|184619 PRK14322, glmM, phosphoglucosamine mutase; Provisional Back     alignment and domain information
>gnl|CDD|100090 cd03088, ManB, ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
cd03085548 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirect 100.0
PRK07564544 phosphoglucomutase; Validated 100.0
PTZ00150593 phosphoglucomutase; Provisional 100.0
cd05801522 PGM_like3 This bacterial PGM-like (phosphoglucomutase-l 100.0
cd05799487 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and P 100.0
KOG0625558 consensus 100.0
) links the anaerobic or aerobic glycolysis of glucose-6-phosphate and glucose-1-phosphate produced by various glycan phosphorylases by catalysing the transfer of a phosphate group between C-1 and C-6 of glucose . Alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.; GO: 0004614 phosphoglucomutase activity, 0005975 carbohydrate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01132">TIGR01132553 pgm phosphoglucomutase, alpha-D-glucose phosphate-speci 100.0
COG0033524 Pgm Phosphoglucomutase [Carbohydrate transport and meta 100.0
PRK10887445 glmM phosphoglucosamine mutase; Provisional 100.0
PRK09542445 manB phosphomannomutase/phosphoglucomutase; Reviewed 100.0
KOG1220607 consensus 100.0
cd05800461 PGM_like2 This PGM-like (phosphoglucomutase-like) prote 100.0
cd05803445 PGM_like4 This PGM-like (phosphoglucomutase-like) domai 100.0
COG1109464 {ManB} Phosphomannomutase [Carbohydrate transport and m 100.0
cd03087439 PGM_like1 This archaeal PGM-like (phosphoglucomutase-li 100.0
TIGR01455450 glmM phosphoglucosamine mutase; InterPro: IPR006352 Thi 100.0
cd05805441 MPG1_transferase GTP-mannose-1-phosphate guanyltransfer 100.0
cd03089443 PMM_PGM The phosphomannomutase/phosphoglucomutase (PMM/ 100.0
cd05802434 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNG 100.0
cd03088459 ManB ManB is a bacterial phosphomannomutase (PMM) that 100.0
cd03084355 phosphohexomutase The alpha-D-phosphohexomutase superfa 100.0
KOG2537539 consensus 99.9
cd03086513 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (p 100.0
PTZ00302604 N-acetylglucosamine-phosphate mutase; Provisional 100.0
pfam02878138 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/ 100.0
pfam02880111 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alph 99.88
pfam02879103 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha 99.86
PTZ00302604 N-acetylglucosamine-phosphate mutase; Provisional 99.12
KOG2537539 consensus 97.19
cd03086513 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (p 99.0
COG0033524 Pgm Phosphoglucomutase [Carbohydrate transport and meta 94.69
pfam0040871 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-ter 98.65
cd03084355 phosphohexomutase The alpha-D-phosphohexomutase superfa 93.65
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 90.92
>cd03085 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes Back     alignment and domain information
>PRK07564 phosphoglucomutase; Validated Back     alignment and domain information
>PTZ00150 phosphoglucomutase; Provisional Back     alignment and domain information
>cd05801 PGM_like3 This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1) Back     alignment and domain information
>KOG0625 consensus Back     alignment and domain information
>TIGR01132 pgm phosphoglucomutase, alpha-D-glucose phosphate-specific; InterPro: IPR005852 Phosphoglucomutase, alpha-D-glucose phosphate-specific (Back     alignment and domain information
>COG0033 Pgm Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10887 glmM phosphoglucosamine mutase; Provisional Back     alignment and domain information
>PRK09542 manB phosphomannomutase/phosphoglucomutase; Reviewed Back     alignment and domain information
>KOG1220 consensus Back     alignment and domain information
>cd05800 PGM_like2 This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria Back     alignment and domain information
>cd05803 PGM_like4 This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes Back     alignment and domain information
>COG1109 {ManB} Phosphomannomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03087 PGM_like1 This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>TIGR01455 glmM phosphoglucosamine mutase; InterPro: IPR006352 This family describes GlmM, phosphoglucosamine mutase, also designated MrsA and YhbF in Escherichia coli , UreC in Helicobacter pylori , and femR315 or FemD in Staphlococcus aureus Back     alignment and domain information
>cd05805 MPG1_transferase GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity Back     alignment and domain information
>cd03089 PMM_PGM The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e Back     alignment and domain information
>cd05802 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily Back     alignment and domain information
>cd03088 ManB ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate Back     alignment and domain information
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>KOG2537 consensus Back     alignment and domain information
>cd03086 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>PTZ00302 N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>pfam02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I Back     alignment and domain information
>pfam02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III Back     alignment and domain information
>pfam02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II Back     alignment and domain information
>PTZ00302 N-acetylglucosamine-phosphate mutase; Provisional Back     alignment and domain information
>KOG2537 consensus Back     alignment and domain information
>cd03086 PGM3 PGM3 (phosphoglucomutase 3), also known as PAGM (phosphoacetylglucosamine mutase) and AGM1 (N-acetylglucosamine-phosphate mutase), is an essential enzyme found in eukaryotes that reversibly catalyzes the conversion of GlcNAc-6-phosphate into GlcNAc-1-phosphate as part of the UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthetic pathway Back     alignment and domain information
>COG0033 Pgm Phosphoglucomutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>pfam00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain Back     alignment and domain information
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase; InterPro: IPR012773 Members of this family of class III pyridoxal-phosphate-dependent aminotransferases are diaminobutyrate--2-oxoglutarate aminotransferase (2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
1lxt_A561 Structure Of Phosphotransferase Phosphoglucomutase 1e-128
1jdy_A561 Rabbit Muscle Phosphoglucomutase Length = 561 1e-126
1kfi_A572 Crystal Structure Of The Exocytosis-Sensitive Phosp 1e-102
3olp_A570 Crystal Structure Of A Bacterial Phosphoglucomutase 3e-86
3na5_A570 Crystal Structure Of A Bacterial Phosphoglucomutase 7e-86
2fuv_A549 Phosphoglucomutase From Salmonella Typhimurium. Len 3e-84
2z0f_A524 Crystal Structure Of Putative Phosphoglucomutase Fr 6e-79
1wqa_A455 Crystal Structure Of Pyrococcus Horikoshii Phosphom 2e-61
1tuo_A464 Crystal Structure Of Putative Phosphomannomutase Fr 4e-61
2f7l_A455 Crystal Structure Of Sulfolobus Tokodaii Phosphoman 2e-58
3bkq_X463 Structure Of The P368g Mutant Of PmmPGM IN COMPLEX 8e-47
2fkf_A462 PhosphomannomutasePHOSPHOGLUCOMUTASE FROM PSEUDOMON 4e-46
1k2y_X463 Crystal Structure Of PhosphomannomutasePHOSPHOGLUCO 4e-46
1p5d_X463 Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Lengt 4e-46
2h4l_X463 Complex Of PmmPGM WITH RIBOSE 1-Phosphate Length = 4e-46
2fkm_X462 PmmPGM S108D MUTANT WITH ALPHA-D-Glucose 1,6-Bispho 4e-46
3i3w_A443 Structure Of A Phosphoglucosamine Mutase From Franc 9e-46
1k35_A463 Crystal Structure Of PhosphomannomutasePHOSPHOGLUCO 2e-43
2dka_A544 Crystal Structure Of N-Acetylglucosamine-Phosphate 4e-07
>gi|1942289|pdb|1LXT|A Chain A, Structure Of Phosphotransferase Phosphoglucomutase From Rabbit Length = 561 Back     alignment and structure
 Score =  462 bits (1189), Expect = e-128,   Method: Composition-based stats.
 Identities = 278/560 (49%), Positives = 376/560 (67%), Gaps = 21/560 (3%)

Query: 3   CTIVPTVPYQDQKPGTSGLRKKVSVFQQ-NSYTENFIQAIFNNVDCAEK---TLVVGGDG 58
              V T  Y DQKPGTSGLRK+V VFQ   +Y ENFIQ+I + V+ A++   TLVVGGDG
Sbjct: 3   IVTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDG 62

Query: 59  RFYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGA 118
           RFY    IQ I++IAAANG  R++IG+ GILSTPAVS +IRK KA GGIILTASHNP G 
Sbjct: 63  RFYMKEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGP 122

Query: 119 TQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEANDVDINHIGTK------ELAN 172
             DFGIK+N S+GG A E  T+ IF+ SK I  Y I     VD+  +G +      +   
Sbjct: 123 NGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKP 182

Query: 173 MTISVIDPIENYVALMENIFDFDAIRKLLSFG--FRIDIDCMNAVTGPYAKEILERKLGA 230
            T+ ++D +E Y  ++ NIFDF+A+++LLS     +I ID M+ V GPY K+IL  +LGA
Sbjct: 183 FTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGA 242

Query: 231 PTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGKGIF 290
           P  S  N +PLEDFGG HPDPNL +A DL    M     DFGAA DGDGDR+MILGK  F
Sbjct: 243 PANSAVNCVPLEDFGGHHPDPNLTYAADLV-ETMKSGEHDFGAAFDGDGDRNMILGKHGF 301

Query: 291 V-NPSDSLAIMVANAGLIPGYAT-GLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFF 348
             NPSDS+A++ AN   IP +   G+ G ARSMPTS ALDRVA    + L+ETPTGWKFF
Sbjct: 302 FVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFF 361

Query: 349 NNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGESLLDIVHKHWATYGR 408
            NL++   +++CGEESFGTGS+H REKDG+W++L WL+ILA R +S+ DI+  HW  +GR
Sbjct: 362 GNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWHKFGR 421

Query: 409 NYYSRYDYLGIPTEKAQDFMNDFRYRL--KNLIGSSFIG----QKIKQAGDFVYTDSTNG 462
           N+++RYDY  +  E A   M D    +  ++ +G  F        +++A +F Y D  +G
Sbjct: 422 NFFTRYDYEEVEAEGATKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYHDPVDG 481

Query: 463 NVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEV 522
           +VS  QG+R++F + SRII+R+SGT +  +T+R+YID+YE D++K  ++ Q ML+ L+ +
Sbjct: 482 SVSKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDNAKINQDPQVMLAPLISI 541

Query: 523 SQRISCLRHYIGHTNPSIAS 542
           + ++S L+   G T P++ +
Sbjct: 542 ALKVSQLQERTGRTAPTVIT 561


>gi|1942196|pdb|1JDY|A Chain A, Rabbit Muscle Phosphoglucomutase Length = 561 Back     alignment and structure
gi|18655888|pdb|1KFI|A Chain A, Crystal Structure Of The Exocytosis-Sensitive Phosphoprotein, Pp63PARAFUSIN (PHOSPHOGLUCOMUTASE) FROM Paramecium Length = 572 Back     alignment and structure
>gi|323463042|pdb|3OLP|A Chain A, Crystal Structure Of A Bacterial Phosphoglucomutase, An Enzyme Important In The Virulence Of Multiple Human Pathogens Length = 570 Back     alignment and structure
>gi|323462896|pdb|3NA5|A Chain A, Crystal Structure Of A Bacterial Phosphoglucomutase, An Enzyme Important In The Virulence Of Several Human Pathogens. Length = 570 Back     alignment and structure
>gi|93279756|pdb|2FUV|A Chain A, Phosphoglucomutase From Salmonella Typhimurium. Length = 549 Back     alignment and structure
gi|160286310|pdb|2Z0F|A Chain A, Crystal Structure Of Putative Phosphoglucomutase From Thermus Thermophilus Hb8 Length = 524 Back     alignment and structure
gi|78100844|pdb|1WQA|A Chain A, Crystal Structure Of Pyrococcus Horikoshii PhosphomannomutasePHOSPHOGLUCOMUTASE COMPLEXED WITH MG2+ Length = 455 Back     alignment and structure
>gi|75765260|pdb|1TUO|A Chain A, Crystal Structure Of Putative Phosphomannomutase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
gi|119389439|pdb|2F7L|A Chain A, Crystal Structure Of Sulfolobus Tokodaii PhosphomannomutasePHOSPHOGLUCOMUTASE Length = 455 Back     alignment and structure
>gi|198443194|pdb|3BKQ|X Chain X, Structure Of The P368g Mutant Of PmmPGM IN COMPLEX WITH Its Substrate Length = 463 Back     alignment and structure
>gi|93279551|pdb|2FKF|A Chain A, PhosphomannomutasePHOSPHOGLUCOMUTASE FROM PSEUDOMONAS Aeruginosa With Alpha-D-Glucose 1,6-Bisphosphate Bound Length = 462 Back     alignment and structure
>gi|20150646|pdb|1K2Y|X Chain X, Crystal Structure Of PhosphomannomutasePHOSPHOGLUCOMUTASE S108a Mutant From P. Aeruginosa Length = 463 Back     alignment and structure
>gi|42543249|pdb|1P5D|X Chain X, Enzyme-Ligand Complex Of P. Aeruginosa PmmPGM Length = 463 Back     alignment and structure
>gi|114794203|pdb|2H4L|X Chain X, Complex Of PmmPGM WITH RIBOSE 1-Phosphate Length = 463 Back     alignment and structure
>gi|93279553|pdb|2FKM|X Chain X, PmmPGM S108D MUTANT WITH ALPHA-D-Glucose 1,6-Bisphosphate Bound Length = 462 Back     alignment and structure
>gi|284055608|pdb|3I3W|A Chain A, Structure Of A Phosphoglucosamine Mutase From Francisella Tularensis Length = 443 Back     alignment and structure
>gi|20150647|pdb|1K35|A Chain A, Crystal Structure Of PhosphomannomutasePHOSPHOGLUCOMUTASE From P.Aeruginosa Length = 463 Back     alignment and structure
gi|109157469|pdb|2DKA|A Chain A, Crystal Structure Of N-Acetylglucosamine-Phosphate Mutase, A Member Of The Alpha-D-Phosphohexomutase Superfamily, In The Apo-Form Length = 544 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
1kfi_A572 Phosphoglucomutase 1; parafusin, phosphoprotein PP63, e 1e-114
3pmg_A561 Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase; H 1e-95
2fuv_A549 Phosphoglucomutase; structural genomics, PSI, protein s 7e-48
2z0f_A524 Putative phosphoglucomutase; isomerase, magnesium, meta 9e-48
3i3w_A443 Phosphoglucosamine mutase; csgid, IDP02164, isomerase, 2e-31
1tuo_A464 Putative phosphomannomutase; thermus thermophilus HB8, 6e-28
1wqa_A455 Phospho-sugar mutase; alpha-beta protein, unphosphoryla 4e-26
2f7l_A455 455AA long hypothetical phospho-sugar mutase; phosphoma 2e-19
1p5d_X463 PMM, phosphomannomutase; alpha/beta protein, phosphohex 8e-38
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 1e-26
>1kfi_A Phosphoglucomutase 1; parafusin, phosphoprotein PP63, exocytosis, isomerase; 2.40A {Paramecium tetraurelia} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1kfq_A Length = 572 Back     alignment and structure
 Score =  406 bits (1044), Expect = e-114
 Identities = 249/570 (43%), Positives = 345/570 (60%), Gaps = 41/570 (7%)

Query: 4   TIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAE----KTLVVGGDGR 59
            +  T PY  QKPGTSGLRKKVS   Q +Y ENF+Q+IFN +   E      L VGGDGR
Sbjct: 9   RVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGR 68

Query: 60  FYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKY-----KASGGIILTASHN 114
           ++N   I  II++A AN  + + +G+ G++STPA SH IRK         GGIILTASHN
Sbjct: 69  YFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHN 128

Query: 115 PAGAT-QDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIE---ANDVDINHIGTK-- 168
           P G    DFGIK+N  +G  A E  T+ I+  + KI  Y  ++      ++++ IG    
Sbjct: 129 PGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKF 188

Query: 169 -----ELANMTISVIDPIENYVALMENIFDFDAIRKLLSF-GFRIDIDCMNAVTGPYAKE 222
                E ++  + V+D +++Y  LM+ +FDFD ++ L S   F    D M+ V GPYAK 
Sbjct: 189 EGTRLEKSHFEVKVVDTVQDYTQLMQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKH 248

Query: 223 ILERKLGAPTGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDS------ADFGAACD 276
           I    LG    S+ N  P EDFGG HPDPNL +A DL + + +H          FGAACD
Sbjct: 249 IFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIHKKKDVGTVPQFGAACD 308

Query: 277 GDGDRSMILGKGIFVNPSDSLAIMVANAGLIPGYATGLVGVARSMPTSAALDRVAEKLNL 336
           GD DR+MILG+  FV PSDSLA++ ANA LI     GL+G ARSMPTS ALD+VA K  +
Sbjct: 309 GDADRNMILGRQFFVTPSDSLAVIAANANLIFKN--GLLGAARSMPTSGALDKVAAKNGI 366

Query: 337 KLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILAVRGE--- 393
           KLFETPTGWKFF NL++ G+I +CGEESFGTGSNH REKDGIW++L WL ILA + +   
Sbjct: 367 KLFETPTGWKFFGNLMDAGLINLCGEESFGTGSNHIREKDGIWAVLAWLTILAHKNKNTD 426

Query: 394 ---SLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKNLIGSSFIGQKIKQ 450
              ++ +IV ++W  +GRNYYSRYDY  + +  A   M   + + +         ++  +
Sbjct: 427 HFVTVEEIVTQYWQQFGRNYYSRYDYEQVDSAGANKMMEHLKTKFQYFEQL----KQGNK 482

Query: 451 AGDFVYTDSTNGNVSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLK 510
           A  + Y D  + +VS  QG+R VF + SRII+R+SGT +  +T+R+Y + +E    +H  
Sbjct: 483 ADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIRIYFEQFEQQQIQHE- 541

Query: 511 NTQEMLSDLVEVSQRISCLRHYIGHTNPSI 540
            T   L++++++   IS +  + G   P++
Sbjct: 542 -TATALANIIKLGLEISDIAQFTGRNEPTV 570


>3pmg_A Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase; HET: SEP; 2.40A {Oryctolagus cuniculus} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1c4g_A* 1jdy_A* 1lxt_A 1vkl_A* 1c47_A* Length = 561 Back     alignment and structure
>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2} Length = 549 Back     alignment and structure
>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} Length = 524 Back     alignment and structure
>3i3w_A Phosphoglucosamine mutase; csgid, IDP02164, isomerase, magnesium, metal-binding, phosphoprotein, structural genomics; HET: SEP; 2.30A {Francisella tularensis subsp} Length = 443 Back     alignment and structure
>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} Length = 464 Back     alignment and structure
>1wqa_A Phospho-sugar mutase; alpha-beta protein, unphosphorylated form, enzyme-metal complex, isomerase; 2.00A {Pyrococcus horikoshii} Length = 455 Back     alignment and structure
>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} Length = 455 Back     alignment and structure
>1p5d_X PMM, phosphomannomutase; alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex, isomerase; HET: SEP G1P; 1.60A {Pseudomonas aeruginosa} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1k35_A* 1p5g_X* 1pcj_X* 1pcm_X* 1k2y_X* 2h5a_X* 2h4l_X* 2fkf_A* 3bkq_X* 3c04_A* 2fkm_X* Length = 463 Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Length = 544 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
3pmg_A561 Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase, p 100.0
1kfi_A572 Phosphoglucomutase 1; parafusin, phosphoprotein PP63, e 100.0
2fuv_A549 Phosphoglucomutase; structural genomics, PSI, protein s 100.0
2z0f_A524 Putative phosphoglucomutase; isomerase, magnesium, meta 100.0
1p5d_X463 PMM, phosphomannomutase; alpha/beta protein, phosphohex 100.0
2f7l_A455 455AA long hypothetical phospho-sugar mutase; phosphoma 100.0
1wqa_A455 Phospho-sugar mutase; alpha-beta protein, unphosphoryla 100.0
1tuo_A464 Putative phosphomannomutase; thermus thermophilus HB8, 100.0
3i3w_A443 Phosphoglucosamine mutase; csgid, IDP02164, isomerase, 100.0
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 100.0
1wjw_A112 Phosphoacetylglucosamine mutase; carbohydrate metabolis 98.82
2dka_A544 Phosphoacetylglucosamine mutase; isomerase; 1.93A {Cand 98.82
>3pmg_A Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase, phosphotransferase; HET: SEP; 2.40A {Oryctolagus cuniculus} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1c4g_A* 1jdy_A* 1lxt_A 1vkl_A* 1c47_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=857.42  Aligned_cols=538  Identities=52%  Similarity=0.901  Sum_probs=460.6

Q ss_pred             EEEECCCCCCCCCCCCCCCEEECCC-CCHHHHHHHHHHHHHHCCC---CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             3520787678888767420450544-4178999999999975465---48838999647678689999999999978987
Q gi|254781107|r    4 TIVPTVPYQDQKPGTSGLRKKVSVF-QQNSYTENFIQAIFNNVDC---AEKTLVVGGDGRFYNHIVIQKIIKIAAANGFA   79 (542)
Q Consensus         4 ~~~~~~~~~~l~FGT~GiRG~~~~~-~~~~~~~~~~~ai~~~~~~---~~~~VvIG~D~R~~S~~~a~~~a~~l~~~Gi~   79 (542)
                      ..+++..|++||||||||||+++.+ .++.++.+++++++..+..   .+++|+||||+|++|++|+++++++|+++|++
T Consensus         4 ~~~~~~~~~~~~fGT~GiRG~v~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~VvIg~D~R~~S~~~a~~~a~~l~s~Gi~   83 (561)
T 3pmg_A            4 VTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIVRIAAANGIG   83 (561)
T ss_dssp             EEEECCCCSCCCCBTTBEEEEHHHHHHSTTHHHHHHHHHHHTSCGGGTTTCEEEEEECCCTTHHHHHHHHHHHHHHTTCC
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCE
T ss_conf             78478656889995876786158888897999999999999998733799879999789614899999999999987997


Q ss_pred             EEEECCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99967898065079999998508981799957657989887773587368786578679889999997405000134446
Q gi|254781107|r   80 RIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEAND  159 (542)
Q Consensus        80 V~~~~~~gi~PTP~~~~av~~~~~~~GImITASHNP~eyN~dnGiK~~~~~G~~~~~~~~~~I~~~~~~~~~~~~~~~~~  159 (542)
                      |+++...|++|||+++|+++++++++||||||||||++||.|||+|||+++|+|+.++.+++|++.++.+......+...
T Consensus        84 V~~~~~~g~~pTP~l~~av~~~~a~~GImITASHNP~~yn~~nGiK~~~~~G~~~~~~~~~~I~~~~~~~~~~~~~~~~~  163 (561)
T 3pmg_A           84 RLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLK  163 (561)
T ss_dssp             EEEEEEEEECCHHHHHHHHHHHTCSEEEEECCTTSCCSTTSEEEEEEEETTSSBCCHHHHHHHHHHHHHCCEEEECTTCC
T ss_pred             EEEECCCCCCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99958889758589999998649986899976689986676506995376776377778999999997334430366444


Q ss_pred             CCHHHCCH------HCCCCCEEEEEEECHHHHHHHHHCCCCHHHHCC--CCCCCEEEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             87121031------002575058984022267543320780322001--3378469985035544012211123105850
Q gi|254781107|r  160 VDINHIGT------KELANMTISVIDPIENYVALMENIFDFDAIRKL--LSFGFRIDIDCMNAVTGPYAKEILERKLGAP  231 (542)
Q Consensus       160 ~~~~~~~~------~~~~~~~~~~~d~~~~Y~~~l~~~~d~~~i~~~--~~~~l~IvvD~~nGa~~~~~~~il~~~lg~~  231 (542)
                      .++...+.      .......++..|..+.|.+++.+.++++.++..  ...+++|++||+||+++.+++++|.+.+|+.
T Consensus       164 ~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~Y~~~l~~~~~~~~~~~~~~~~~~lkIv~D~~nG~~~~~~~~iL~~~lg~~  243 (561)
T 3pmg_A          164 VDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAP  243 (561)
T ss_dssp             CCTTSCEEEEECCTTCSSCEEEEEECSSHHHHHHHHTTSCHHHHHHHHHSTTCCCEEEECTTSTTHHHHHHHHTTTTCCC
T ss_pred             CCCCCCCCCCCCHHHCCCCCEEEEECHHHHHHHHHHHHCCHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             44000253013444404676079823099999999863487777776414678469995477611333365538761884


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEEEEEECCCCCEEEEECC-CCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             12332015787547644685422210478886122586078986488745688538-87227465999999999872020
Q gi|254781107|r  232 TGSVRNFIPLEDFGGCHPDPNLIHAKDLYDRMMMHDSADFGAACDGDGDRSMILGK-GIFVNPSDSLAIMVANAGLIPGY  310 (542)
Q Consensus       232 ~~~~~~~~pd~~F~~~~PnP~~~~~~~l~~~~~~~~~aDlgiA~DgDaDR~~ivd~-g~~i~~~d~l~ll~~~~~~~~~~  310 (542)
                      +....|+.||++||+++|||+.+++.++. +.+++.++|+|+|+||||||++++|+ |.++.+++++++++.+++.....
T Consensus       244 ~~~~~~~~~d~~f~~~~p~p~~~~~~~l~-~~v~~~~aDlgia~DgDaDR~~ivd~~G~~i~~~~~~all~~~~l~~~~~  322 (561)
T 3pmg_A          244 ANSAVNCVPLEDFGGHHPDPNLTYAADLV-ETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYF  322 (561)
T ss_dssp             GGGEESCSCCTTGGGSCCCCSTTTTHHHH-HHHHTSCCSEEEEECTTSSCEEEEEGGGCBCCHHHHHHHHHHTGGGSHHH
T ss_pred             CEEEEEEEECCCCCCCCCCCCCHHHHHHH-HHHHHCCCCEEEECCCCCCEEEEEECCCCEEECCCHHHHHHHHHHHHHHH
T ss_conf             20467645569988677899822499999-98860176445420588856899968972871651799999999973353


Q ss_pred             -CCCCCEEEEECCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCCCEEEECCCCCEECCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             -4787168753108379999840476159982863266542102697388621123013474215751678999999997
Q gi|254781107|r  311 -ATGLVGVARSMPTSAALDRVAEKLNLKLFETPTGWKFFNNLLENGMITICGEESFGTGSNHSREKDGIWSILFWLNILA  389 (542)
Q Consensus       311 -~~~~~~vv~t~~sS~~i~~ia~~~g~~~~~t~vGfk~I~~~m~~~~~~~ggEeS~G~~~~~~~dkDgi~aal~~le~la  389 (542)
                       ......||+|++||.+++++++++|+++++|+||||||++.|.+.++.||||||+|++++|+++|||++++++++++++
T Consensus       323 ~~~~~~~vv~t~~ss~~i~~ia~~~g~~v~~t~tG~k~i~~~~~~~~~~~ggEesgg~~~~~~~~kDgi~a~l~~le~l~  402 (561)
T 3pmg_A          323 QQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILA  402 (561)
T ss_dssp             HHHCCCCEEEETTSCTHHHHHHHTSSSCEEEECSSHHHHHHHHHTTCCSEEEETTTEEEETTSSSCCHHHHHHHHHHHHH
T ss_pred             HCCCCCEEEECCCCCCHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCEEEEEECCCEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             14887469866665807777898659369871774699999998459779885257262156899838999999999999


Q ss_pred             HCCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHHH--CCCCCCCC----CEEHHHHHHHCCCCCCCC
Q ss_conf             246888999988998829661211001368778999999999987753--16521156----420100000001134677
Q gi|254781107|r  390 VRGESLLDIVHKHWATYGRNYYSRYDYLGIPTEKAQDFMNDFRYRLKN--LIGSSFIG----QKIKQAGDFVYTDSTNGN  463 (542)
Q Consensus       390 ~~gk~l~d~l~el~~~yG~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~--~~~~~~~~----~~v~~~~d~~~~~~~~~~  463 (542)
                      .++++|++++++++++||++++.+.+....+.+....++..++..+.+  ..+..+..    .++....++.+.+..+++
T Consensus       403 ~~~k~l~~~l~el~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~  482 (561)
T 3pmg_A          403 TRKQSVEDILKDHWHKFGRNFFTRYDYEEVEAEGATKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYHDPVDGS  482 (561)
T ss_dssp             HHCSCHHHHHHHHHHHHCEEEEEEEEEEEECHHHHHHHHHHHHHHHHSTTSTTCEEEETTEEEEEEEEEECCEECTTTCC
T ss_pred             HHCCCHHHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCCCCCCCCCCC
T ss_conf             83989999999888883875466314456778889999999998652133236400245431567651233345754576


Q ss_pred             CCCCCEEEEEECCCEEEEEECCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             3746708999889919999758888785589999995289978999999999999999999985066883789997579
Q gi|254781107|r  464 VSDKQGIRVVFDNHSRIIYRISGTDTENSTLRVYIDNYEPDSSKHLKNTQEMLSDLVEVSQRISCLRHYIGHTNPSIAS  542 (542)
Q Consensus       464 i~~~dGik~~~~d~~wiliRpSGTEPk~~~iRiy~E~~~~~~~~~l~~~~~~l~~li~~~~~~~~~~~~~~~~~~~~~~  542 (542)
                      ++++||+|+.|+||+|+++|||||||..++||||+|+++++.++.+.+.++.++++++.++++.++++++|+++|||+|
T Consensus       483 i~~~dglk~~~~dg~wi~vRpSGTEP~~~~iRiY~Ea~~~d~a~~~~~~~~~l~~~i~~~~~~~~~~~~~g~~~~~~~~  561 (561)
T 3pmg_A          483 VSKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDNAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT  561 (561)
T ss_dssp             EECCCCEEEEETTSCEEEEEEEECSSSCEEEEEEEEEEECCTTTTTSCHHHHHHHHHHHHHHHHTHHHHHCCSSCSEEC
T ss_pred             CCCCCEEEEEECCCEEEEEECCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCCCCCC
T ss_conf             6677759999779859999856788998129999987795588898999999999999999985868886889998619



>1kfi_A Phosphoglucomutase 1; parafusin, phosphoprotein PP63, exocytosis, isomerase; 2.40A {Paramecium tetraurelia} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1kfq_A Back     alignment and structure
>2fuv_A Phosphoglucomutase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, isomerase; HET: MSE; 2.00A {Salmonella typhimurium LT2} Back     alignment and structure
>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} Back     alignment and structure
>1p5d_X PMM, phosphomannomutase; alpha/beta protein, phosphohexomutase, phosphoserine, enzyme-ligand complex, enzyme-metal complex, isomerase; HET: SEP G1P; 1.60A {Pseudomonas aeruginosa} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1k35_A* 1p5g_X* 1pcj_X* 1pcm_X* 1k2y_X* 2h5a_X* 2h4l_X* 2fkf_A* 3bkq_X* 3c04_A* 2fkm_X* Back     alignment and structure
>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>1wqa_A Phospho-sugar mutase; alpha-beta protein, unphosphorylated form, enzyme-metal complex, isomerase; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} Back     alignment and structure
>3i3w_A Phosphoglucosamine mutase; csgid, IDP02164, isomerase, magnesium, metal-binding, phosphoprotein, structural genomics; HET: SEP; 2.30A {Francisella tularensis subsp} Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Back     alignment and structure
>1wjw_A Phosphoacetylglucosamine mutase; carbohydrate metabolism, structural genomics, riken structural genomics/proteomics initiative, RSGI, isomerase; NMR {Mus musculus} SCOP: d.129.2.1 Back     alignment and structure
>2dka_A Phosphoacetylglucosamine mutase; isomerase; 1.93A {Candida albicans} PDB: 2dkc_A* 2dkd_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
d1kfia1203 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, 1e-45
d3pmga1190 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctola 7e-38
d3pmga4141 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryct 5e-43
d1kfia4129 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprote 1e-38
d1kfia3120 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotei 7e-24
d3pmga3117 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Orycto 2e-23
d1kfia2118 c.84.1.1 (A:206-323) Exocytosis-sensitive phosphoprotei 4e-23
d3pmga2113 c.84.1.1 (A:191-303) Phosphoglucomutase {Rabbit (Orycto 1e-19
d1p5dx2104 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomut 3e-06
>d1kfia1 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 203 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Exocytosis-sensitive phosphoprotein, pp63/parafusin
species: Paramecium tetraurelia [TaxId: 5888]
 Score =  178 bits (452), Expect = 1e-45
 Identities = 81/196 (41%), Positives = 112/196 (57%), Gaps = 20/196 (10%)

Query: 4   TIVPTVPYQDQKPGTSGLRKKVSVFQQNSYTENFIQAIFNNVDCAEK----TLVVGGDGR 59
            +  T PY  QKPGTSGLRKKVS   Q +Y ENF+Q+IFN +   E      L VGGDGR
Sbjct: 7   RVQVTQPYAGQKPGTSGLRKKVSEATQPNYLENFVQSIFNTLRKDELKPKNVLFVGGDGR 66

Query: 60  FYNHIVIQKIIKIAAANGFARIIIGKGGILSTPAVSHLIRKY-----KASGGIILTASHN 114
           ++N   I  II++A AN  + + +G+ G++STPA SH IRK         GGIILTASHN
Sbjct: 67  YFNRQAIFSIIRLAYANDISEVHVGQAGLMSTPASSHYIRKVNEEVGNCIGGIILTASHN 126

Query: 115 PAGAT-QDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIE---ANDVDINHIGTKEL 170
           P G    DFGIK+N  +G  A E  T+ I+  + KI  Y  ++      ++++ IG  + 
Sbjct: 127 PGGKEHGDFGIKFNVRTGAPAPEDFTDQIYTHTTKIKEYLTVDYEFEKHINLDQIGVYKF 186

Query: 171 -------ANMTISVID 179
                  ++  + V+D
Sbjct: 187 EGTRLEKSHFEVKVVD 202


>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 190 Back     information, alignment and structure
>d3pmga4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 141 Back     information, alignment and structure
>d1kfia4 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 129 Back     information, alignment and structure
>d1kfia3 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 120 Back     information, alignment and structure
>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 117 Back     information, alignment and structure
>d1kfia2 c.84.1.1 (A:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Length = 118 Back     information, alignment and structure
>d3pmga2 c.84.1.1 (A:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 113 Back     information, alignment and structure
>d1p5dx2 c.84.1.1 (X:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 104 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target542 phosphoglucomutase [Candidatus Liberibacter asiaticus s
d3pmga1190 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 100.0
d1kfia1203 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 100.0
d1p5dx1146 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 100.0
d3pmga4141 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 99.93
d1kfia4129 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 99.9
d1p5dx496 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.42
d3pmga3117 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 99.93
d1kfia3120 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 99.92
d1p5dx3109 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.79
d3pmga2113 Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [Tax 99.91
d1kfia2118 Exocytosis-sensitive phosphoprotein, pp63/parafusin {Pa 99.89
d1p5dx2104 Phosphomannomutase/phosphoglucomutase {Pseudomonas aeru 99.85
d1wjwa_112 Phosphoacetylglucosamine mutase {Mouse (Mus musculus) [ 98.91
>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Phosphoglucomutase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=100.00  E-value=0  Score=314.69  Aligned_cols=160  Identities=61%  Similarity=0.923  Sum_probs=140.1

Q ss_pred             EEEECCCCCCCCCCCCCCCEEECCCCC-HHHHHHHHHHHHHHCCC---CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             352078767888876742045054441-78999999999975465---48838999647678689999999999978987
Q gi|254781107|r    4 TIVPTVPYQDQKPGTSGLRKKVSVFQQ-NSYTENFIQAIFNNVDC---AEKTLVVGGDGRFYNHIVIQKIIKIAAANGFA   79 (542)
Q Consensus         4 ~~~~~~~~~~l~FGT~GiRG~~~~~~~-~~~~~~~~~ai~~~~~~---~~~~VvIG~D~R~~S~~~a~~~a~~l~~~Gi~   79 (542)
                      .-||+.||+++|||||||||+++.++. ..++.++++++++++..   .+++|+||||+|++|++|++.++++|+++|++
T Consensus         4 ~~~~~~~~~~~kfGTdGiRG~~g~~~~~~~~~~~~~~a~~~~~~~~~~~~~~vvIG~D~R~ss~~~a~~~a~~l~~~g~~   83 (190)
T d3pmga1           4 VTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIVRIAAANGIG   83 (190)
T ss_dssp             EEEECCCCSCCCCBTTBEEEEHHHHHHSTTHHHHHHHHHHHTSCGGGTTTCEEEEEECCCTTHHHHHHHHHHHHHHTTCC
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCE
T ss_conf             78557546899985746686068888898999999999999998744898569997177708899999999999754630


Q ss_pred             EEEECCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             99967898065079999998508981799957657989887773587368786578679889999997405000134446
Q gi|254781107|r   80 RIIIGKGGILSTPAVSHLIRKYKASGGIILTASHNPAGATQDFGIKYNTSSGGSASEQQTEDIFEESKKITSYQIIEAND  159 (542)
Q Consensus        80 V~~~~~~gi~PTP~~~~av~~~~~~~GImITASHNP~eyN~dnGiK~~~~~G~~~~~~~~~~I~~~~~~~~~~~~~~~~~  159 (542)
                      |+++.++|++|||+++|+++++++++||||||||||++||.|||+|||+++|+++.++.+++|++.++++..+...+..+
T Consensus        84 v~~~~~~g~~pTP~~~~~~~~~~~~~GimITASHNP~ep~~~NG~K~~~~~G~~~~~~~~~~I~~~~~~i~~~~~~~~~~  163 (190)
T d3pmga1          84 RLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLK  163 (190)
T ss_dssp             EEEEEEEEECCHHHHHHHHHHHTCSEEEEECCTTSCCSTTSEEEEEEEETTSSBCCHHHHHHHHHHHHHCCEEEECTTCC
T ss_pred             EEEECCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             58843787656558998877538745789736657787577776999899998997799999999997413430487566


Q ss_pred             CCHH
Q ss_conf             8712
Q gi|254781107|r  160 VDIN  163 (542)
Q Consensus       160 ~~~~  163 (542)
                      +++.
T Consensus       164 ~dl~  167 (190)
T d3pmga1         164 VDLG  167 (190)
T ss_dssp             CCTT
T ss_pred             CCHH
T ss_conf             5763



>d1kfia1 c.84.1.1 (A:3-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Back     information, alignment and structure
>d1p5dx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3pmga4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kfia4 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia [TaxId: 5888]} Back     information, alignment and structure