254781108

254781108

von Willebrand factor type A

GeneID in NCBI database:8210133Locus tag:CLIBASIA_05050
Protein GI in NCBI database:254781108Protein Accession:YP_003065521.1
Gene range:+(1109746, 1110942)Protein Length:398aa
Gene description:von Willebrand factor type A
COG prediction:none
KEGG prediction:von Willebrand factor type A
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccEEcccccHHHHHEEEEEcccccHHHHHHHccccccccccHHHHHcccHHHHHcccccccccEEcccccEEEEEEEEEEHHHHHHHHHHHHcccccccccccEEccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHcccccEEEEEEEEEccccccccEEEccccHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccHHEEEEEEEEEccccccccccccccHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHccEEccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHcHHHHcccEcEcccccccEEEEEEEEcEEEEccccHHHHHHccHHccccEEccccEEEEccccccEEEEEEEEccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHccccccHHHHEEEcccccEEEEEEEEEcHHHHHcccccccccccccEEHHccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHcccEEEEEEEEcccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASivsdrtikdpttkkdqtSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINitkdknnplqYIAESkaqyeiptenlflkglipsaltnlslrstgiierssenLAISICMVLDVSRSMEDLYLQKhndnnnmtsnkyllppppkksfwsknttkskyapapapanrkIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAynigivgnqctplsnnLNEVKSRLnklnpyentntypaMHHAYRELYnekesshntigstrLKKFVIFITdgensgasaYQNTLNTLQICEYMRNAGMKIYSvavsappegqdLLRKctdssgqffavndSRELLESFDKITDKIQEQSVRIAPNR
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASivsdrtikdpttkkdqtstifkkQIKKHLKQGSYIRENAGDIAQKAQinitkdknnPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGiierssenlAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTkskyapapapanRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESfdkitdkiqeqsvriapnr
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVS*********KKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRST********NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN***********TRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQ*V*I****
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKD*********TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN********IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQ**********
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRS***L*****NDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSH**IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPN*
iiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR
MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFLKGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target398 von Willebrand factor type A [Candidatus Liberibacter a
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Li 2e-21
254781110420 von Willebrand factor type A [Candidatus Liberibac 8e-14
254781110420 von Willebrand factor type A [Candidatus Liberibac 0.032
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 3e-11
254780388458 hypothetical protein CLIBASIA_01365 [Candidatus Li 4e-08
254780135408 hypothetical protein CLIBASIA_00070 [Candidatus Li 0.043
>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment
 Score = 94.7 bits (234), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 185/401 (46%), Gaps = 62/401 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TAI++ V F+ +   I+ +H  +++ ++   LD ++L     I++     +   +K+  
Sbjct: 20  LTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNNGKKQKNDF 79

Query: 61  S-----TIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
           S      I++   +  L++  +  ++  +I +   ++I  D  +   Y   + ++YE+P 
Sbjct: 80  SYRIIKNIWQTDFRNELRENGF-AQDINNIERSTSLSIIIDDQHK-DYNLSAVSRYEMP- 136

Query: 116 ENLFLKGLIPSAL--TNLSLRSTGIIERSSE-NLAISICMVLDVSRSMEDLYLQKHNDNN 172
              F+    P     ++  L  T  ++ SS+ ++ + + MVLDVS SM D +        
Sbjct: 137 ---FIFCTFPWCANSSHAPLLITSSVKISSKSDIGLDMMMVLDVSLSMNDHF-------- 185

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                                           P   K+ V   S   +++ I K+I +  
Sbjct: 186 -------------------------------GPGMDKLGVATRSIREMLDII-KSIPDVN 213

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK 292
           N+ VR G + ++  IV  Q  PL+  +  ++ ++N+L     T + P + +AY ++++ K
Sbjct: 214 NV-VRSGLVTFSSKIV--QTFPLAWGVQHIQEKINRLIFGSTTKSTPGLEYAYNKIFDAK 270

Query: 293 ES-SHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPP 351
           E   H   G    KK++IF+TDGENS  +   +   +L  C   +  G  +Y++ V A  
Sbjct: 271 EKLEHIAKGHDDYKKYIIFLTDGENSSPNI--DNKESLFYCNEAKRRGAIVYAIGVQAEA 328

Query: 352 EGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
             Q  L+ C  S  +F++V +SR+L ++F +I  ++ +Q +
Sbjct: 329 ADQ-FLKNCA-SPDRFYSVQNSRKLHDAFLRIGKEMVKQRI 367

>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Back     alignment
 Score = 69.7 bits (169), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 69/118 (58%), Gaps = 11/118 (9%)

Query: 275 TNTYPAMHHAYRELYNEKESSHNT--------IGSTRLKKFVIFITDGENSGASAYQNTL 326
           T++ PAM  AY+ L ++K+ S  T        I S   +KF+IF+TDGEN+    +++ +
Sbjct: 292 TDSTPAMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNN---FKSNV 348

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVNDSRELLESFDKIT 384
           NT++IC+  +   +KI +++++A P GQ LL+ C  S    + V ++  L+  F  I+
Sbjct: 349 NTIKICDKAKENFIKIVTISINASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNIS 406

>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Back     alignment
 Score = 31.2 bits (69), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 15/102 (14%)

Query: 12  FITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVS------DR--TIKDPTTKK--DQTS 61
           F+ Y +D     Y +N M+SA +AA+L+G + +VS      DR  +I +   +   D   
Sbjct: 39  FLIYVLDWH---YKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNHAKRALIDDAK 95

Query: 62  TIFKKQIKKHLKQGSYIRENA--GDIAQKAQINITKDKNNPL 101
              K  IK+ L   S +  N    +I   ++I++T   NN L
Sbjct: 96  RFIKNHIKESLSGYSAVFYNTEIQNIVNSSRISMTHMANNRL 137

>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 171/402 (42%), Gaps = 63/402 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKD-- 58
           +TAI + + FL +   I+++HI +++  + S +D +++     I+++    +    K   
Sbjct: 22  LTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKKLKGGD 81

Query: 59  ---QTSTIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPT 115
              +    +    +  L+   ++ +   DI +   ++I     N   Y   + ++Y+IP 
Sbjct: 82  ILCRIKNTWNMSFRNELRDNGFVND-IDDIVRSTSLDIVVVPQNE-GYSISAISRYKIPL 139

Query: 116 ENLFLKGLIPSALT--NLSLRSTGIIERSSENLA-ISICMVLDVSRSMEDLYLQKHNDNN 172
           +       IP      ++ +  T  ++ +S+  A + + +VLDVSRSME           
Sbjct: 140 K---FCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSME----------- 185

Query: 173 NMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKK 232
                          SF+  + TK             ID+ I+S   ++  + K I +  
Sbjct: 186 ---------------SFFDSSITK-------------IDMAIKSINAMLEEV-KLIPDVN 216

Query: 233 NLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYE-NTNTYPAMHHAYRELYN- 290
           N+ V+ G + ++  I   +   L   ++ ++ ++  L+ +  +TN+ P + +AY ++++ 
Sbjct: 217 NV-VQSGLVTFSNKI--EEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273

Query: 291 EKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAP 350
           +    H        KK ++F+TDGEN      Q    +L  C   +  G  +Y++ +   
Sbjct: 274 QGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQ---QSLYYCNEAKKRGAIVYAIGIRV- 329

Query: 351 PEGQDLLRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
               + LR C  S   F+ V +   + ++F  I   I  + +
Sbjct: 330 IRSHEFLRACA-SPNSFYLVENPHSMYDAFSHIGKDIVTKRI 370

>gi|254780388|ref|YP_003064801.1| hypothetical protein CLIBASIA_01365 [Candidatus Liberibacter asiaticus str. psy62] Length = 458 Back     alignment
 Score = 50.4 bits (119), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 94/448 (20%), Positives = 192/448 (42%), Gaps = 70/448 (15%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           +TA+++ V        +D+    Y  + ++ A   A+++    ++  +++++ +++   +
Sbjct: 25  ITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI--QSLEEVSSRAKNS 82

Query: 61  STIFKKQIKKHLKQG--SYIRENAGDIAQKAQINITKDKNNP----LQYIAESKAQYEIP 114
            T  K++I+++L +   + +++N  D   +  +  T  + NP     Q +  S+    + 
Sbjct: 83  FTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLN 142

Query: 115 TENLFLKGL-IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173
             +LFL+ + I S L      +  +     +   +SI  V+D SRSM D       D+  
Sbjct: 143 PLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY----QRDSEG 198

Query: 174 MTSNKYLLPPPPK-KSFWSKN----TTKSKYAPA-------------PAPAN-------- 207
              N +  P     KS+ S+N        K +P              P P +        
Sbjct: 199 QPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHF 258

Query: 208 ----------RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSN 257
                     +K  ++ ++  +++ SI+K   +  N +VR+G   +N  ++ +     S 
Sbjct: 259 VDSSSLRHVIKKKHLVRDALASVIRSIKKI--DNVNDTVRMGATFFNDRVISD--PSFSW 314

Query: 258 NLNE-----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFI 311
            +++     VK+     N   +T    AM  AY  + +  E   H    +   KK+++ +
Sbjct: 315 GVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLL 374

Query: 312 TDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD----LLRKCTDSSGQF 367
           TDGEN+     Q+    + IC   ++ G++I ++A S     Q+     L  C  S   F
Sbjct: 375 TDGENT-----QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCA-SPNSF 428

Query: 368 FAVNDSRELLESF-DKITDKIQEQSVRI 394
           F  N + EL + F D+I ++I E+ +RI
Sbjct: 429 FEANSTHELNKIFRDRIGNEIFERVIRI 456

>gi|254780135|ref|YP_003064548.1| hypothetical protein CLIBASIA_00070 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score = 30.8 bits (68), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 300 GSTRLKKFVIFITDGENSGASAYQNTLN-TLQICEYMR------NAGMKIYSVAVSAPPE 352
           G++  K  ++F    + S +S  + T++  LQ C YM          + I+SV  S   +
Sbjct: 299 GASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQD 358

Query: 353 GQDLLRKCTDSSGQFFAVNDSRELL 377
            +  LR+C     +++ +N    ++
Sbjct: 359 TRYTLRQCASDPSKYYEINSDENVM 383

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target398 von Willebrand factor type A [Candidatus Liberibacter a
315122473403 von Willebrand factor type A [Candidatus Liberibacter s 1 7e-55
327189644415 hypothetical protein RHECNPAF_570041 [Rhizobium etli CN 1 6e-18
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib 1 2e-17
163760496363 hypothetical protein HPDFL43_04296 [Hoeflea phototrophi 1 3e-17
209550922411 von Willebrand factor type A [Rhizobium leguminosarum b 1 2e-15
315122347362 hypothetical protein CKC_02995 [Candidatus Liberibacter 1 3e-15
218662625389 hypothetical protein RetlI_26027 [Rhizobium etli IE4771 1 4e-15
241206334400 hypothetical protein Rleg_3648 [Rhizobium leguminosarum 1 4e-15
86359182411 hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42 1 8e-15
190893432410 hypothetical protein RHECIAT_CH0003859 [Rhizobium etli 1 1e-14
>gi|315122473|ref|YP_004062962.1| von Willebrand factor type A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 403 Back     alignment and organism information
 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 138/402 (34%), Positives = 230/402 (57%), Gaps = 29/402 (7%)

Query: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60
           M+A II VC +F+++ ID+ H+++++N +QS+LD A++SGC+ +VSD  I D   ++++ 
Sbjct: 27  MSASIIFVCLIFVSFVIDITHLLHMKNHIQSSLDNAIISGCSIVVSDPKINDLNPQEERI 86

Query: 61  STIFKKQIKKHLKQGSYIRENAGDIAQKAQINITKDKNNPLQYIAESKAQYEIPTENLFL 120
             + KK    ++ Q ++  E+A  I + A I+ +KD  N  +Y    +A++++  +N  L
Sbjct: 87  RDVIKKNAYVNMVQ-NFPAEHAAYIIENANISFSKDLTNKYEYKITMEAKHQLSGKNFIL 145

Query: 121 KGLIPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYL 180
             L+P+ +T++S  STGII++ S+  A S+ MVLD S SM D  +Q+  D ++     Y 
Sbjct: 146 GFLMPNVITHISSISTGIIQKPSDKKAFSVEMVLDCSGSMLD-SMQESCDLSSGRGGYY- 203

Query: 181 LPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGT 240
                   F+SKN  K K          KI  L  ++ + VN IQ+ +Q    +S RIG 
Sbjct: 204 --------FYSKNNNKPK---------SKIYALKTASSDFVNLIQETVQTFPQISARIGL 246

Query: 241 IAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYN--EKESSHNT 298
           I +N  I+  Q + LSNN N +K  ++++ P   T+T+  M+ AY  L N   +  +HN 
Sbjct: 247 ITFNHYIM--QDSKLSNNFNVIKKTISRMKPKGGTDTFLPMNAAYEYLNNIPNETKAHNI 304

Query: 299 IGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVS--APPEGQDL 356
             +  LK+++I +TDGEN+  S     L T+ +C+  R  G+ IYS+ ++     +G +L
Sbjct: 305 SDNVPLKRYIILMTDGENNHPSY---DLKTINVCDNARKNGIIIYSIFLNYYEYTDGYEL 361

Query: 357 LRKCTDSSGQFFAVNDSRELLESFDKITDKIQEQSVRIAPNR 398
            RKC  S   FF  N+++ LL+SF  I   IQ+++VRIA N 
Sbjct: 362 ARKCASSEKHFFYANNTKALLDSFKSIAHAIQDKAVRIASNE 403


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512] Length = 415 Back     alignment and organism information
>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment and organism information
>gi|163760496|ref|ZP_02167578.1| hypothetical protein HPDFL43_04296 [Hoeflea phototrophica DFL-43] Length = 363 Back     alignment and organism information
>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 411 Back     alignment and organism information
>gi|315122347|ref|YP_004062836.1| hypothetical protein CKC_02995 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 362 Back     alignment and organism information
>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771] Length = 389 Back     alignment and organism information
>gi|241206334|ref|YP_002977430.1| hypothetical protein Rleg_3648 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 400 Back     alignment and organism information
>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42] Length = 411 Back     alignment and organism information
>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652] Length = 410 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 von Willebrand factor type A [Candidatus Liberibacter a
smart00327177 smart00327, VWA, von Willebrand factor (vWF) type A dom 6e-06
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) domai 6e-06
pfam00092177 pfam00092, VWA, von Willebrand factor type A domain 1e-05
>gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 398 von Willebrand factor type A [Candidatus Liberibacter a
PRK13685326 hypothetical protein; Provisional 99.92
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor type A 99.89
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor type 99.88
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin 99.83
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extr 99.82
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) typ 99.8
cd01470198 vWA_complement_factors Complement factors B and C2 are 99.8
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor ty 99.79
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is 99.78
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel like: V 99.75
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type 99.72
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelata 99.71
cd01469177 vWA_integrins_alpha_subunit Integrins are a class of ad 99.69
cd01472164 vWA_collagen von Willebrand factor (vWF) type A domain; 99.69
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhe 99.69
pfam00092177 VWA von Willebrand factor type A domain. 99.66
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA doma 99.65
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) li 99.65
TIGR00868 874 hCaCC calcium-activated chloride channel protein 1; Int 99.65
cd01471186 vWA_micronemal_protein Micronemal proteins: The Toxopla 99.64
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor type 99.61
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extracellula 99.6
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebrates) 99.6
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. Memb 99.48
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] 99.32
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand facto 99.14
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 98.76
COG4245207 TerY Uncharacterized protein encoded in toxicity protec 98.75
KOG2353 1104 consensus 98.73
TIGR02031705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 98.48
cd01453183 vWA_transcription_factor_IIH_type Transcription factors 98.23
pfam04056250 Ssl1 Ssl1-like. Ssl1-like proteins are 40kDa subunits o 95.82
KOG2807 378 consensus 94.26
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) d 99.66
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was orig 99.55
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor 98.26
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type 99.46
cd01454174 vWA_norD_type norD type: Denitrifying bacteria contain 99.29
COG2425437 Uncharacterized protein containing a von Willebrand fac 97.89
pfam05762223 VWA_CoxE VWA domain containing CoxE-like protein. This 97.16
COG2304 399 Uncharacterized protein containing a von Willebrand fac 95.74
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) do 95.29
pfam11443524 DUF2828 Domain of unknown function (DUF2828). This is a 90.5
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 98.75
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.62
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a major 96.82
COG4548637 NorD Nitric oxide reductase activation protein [Inorgan 97.83
pfam06707206 DUF1194 Protein of unknown function (DUF1194). This fam 97.11
pfam00362424 Integrin_beta Integrin, beta chain. Integrins have been 97.0
smart00187423 INB Integrin beta subunits (N-terminal portion of extra 96.82
pfam11775220 CobT_C Cobalamin biosynthesis protein CobT VWA domain. 96.51
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heterodime 95.63
COG4867652 Uncharacterized protein with a von Willebrand factor ty 92.65
COG4655 565 Predicted membrane protein [Function unknown] 96.78
pfam0781143 TadE TadE-like protein. The members of this family are 95.26
KOG1226 783 consensus 93.14
pfam09967412 DUF2201 Predicted metallopeptidase (DUF2201). This doma 92.13
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>pfam00092 VWA von Willebrand factor type A domain Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1; InterPro: IPR004727 This entry represents a family of Ca(2+)-regulated chloride channels (CLCA) which includes bovine, murine and human proteins , Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804 Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>KOG2353 consensus Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D; InterPro: IPR011776 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>pfam04056 Ssl1 Ssl1-like Back     alignment and domain information
>KOG2807 consensus Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>pfam05762 VWA_CoxE VWA domain containing CoxE-like protein Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>pfam11443 DUF2828 Domain of unknown function (DUF2828) Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam06707 DUF1194 Protein of unknown function (DUF1194) Back     alignment and domain information
>pfam00362 Integrin_beta Integrin, beta chain Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>pfam11775 CobT_C Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>KOG1226 consensus Back     alignment and domain information
>pfam09967 DUF2201 Predicted metallopeptidase (DUF2201) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target398 von Willebrand factor type A [Candidatus Liberibacter a
3n2n_F185 The Crystal Structure Of Tumor Endothelial Marker 8 2e-08
3k6s_A 1095 Structure Of Integrin Alphaxbeta2 Ectodomain Length 1e-07
2b2x_A223 Vla1 Rdeltah I-Domain Complexed With A Quadruple Mu 1e-07
1n3y_A198 Crystal Structure Of The Alpha-X Beta2 Integrin I D 2e-06
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 4e-05
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 4e-05
2win_I 507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 6e-05
2ok5_A 752 Human Complement Factor B Length = 752 6e-05
1q0p_A223 A Domain Of Factor B Length = 223 0.003
1bhq_1189 Mac-1 I Domain Cadmium Complex Length = 189 4e-07
1idn_1190 Mac-1 I Domain Metal Free Length = 190 4e-07
1na5_A197 Integrin Alpha M I Domain Length = 197 4e-07
1mf7_A194 Integrin Alpha M I Domain Length = 194 4e-07
1jlm_A192 I-Domain From Integrin Cr3, Mn2+ Bound Length = 192 4e-07
1ido_A189 I-Domain From Integrin Cr3, Mg2+ Bound Length = 189 3e-06
1m1u_A195 An Isoleucine-Based Allosteric Switch Controls Affi 3e-06
1n9z_A192 Integrin Alpha M I Domain Mutant Length = 192 4e-06
>gi|316983245|pdb|3N2N|F Chain F, The Crystal Structure Of Tumor Endothelial Marker 8 (Tem8) Extracellular Domain Length = 185 Back     alignment and structure
 Score = 65.3 bits (157), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 65/187 (34%), Gaps = 18/187 (9%)

Query: 204 APANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVK 263
                K   ++     +   +++   +  +  +R+  I ++          L+ +  +++
Sbjct: 11  YFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGT--TLMKLTEDREQIR 68

Query: 264 SRLNKLN---PYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGAS 320
             L +L    P  +T  +     A  ++Y E    + T         +I +TDGE     
Sbjct: 69  QGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRT------ASVIIALTDGELHEDL 122

Query: 321 AYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND-SRELLES 379
            + +           R+ G  +Y+V V      +  L +  DS    F VND  + L   
Sbjct: 123 FFYSERE----ANRSRDLGAIVYAVGV--KDFNETQLARIADSKDHVFPVNDGFQALQGI 176

Query: 380 FDKITDK 386
              I  K
Sbjct: 177 IHSILKK 183


>gi|283807143|pdb|3K6S|A Chain A, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 1095 Back     alignment and structure
>gi|99031847|pdb|2B2X|A Chain A, Vla1 Rdeltah I-Domain Complexed With A Quadruple Mutant Of The Aqc2 Fab Length = 223 Back     alignment and structure
>gi|28948724|pdb|1N3Y|A Chain A, Crystal Structure Of The Alpha-X Beta2 Integrin I Domain Length = 198 Back     alignment and structure
>gi|317455060|pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>gi|251837060|pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>gi|239781743|pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>gi|134105218|pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>gi|47168593|pdb|1Q0P|A Chain A, A Domain Of Factor B Length = 223 Back     alignment and structure
>gi|157838288|pdb|1BHQ|1 Chain 1, Mac-1 I Domain Cadmium Complex Length = 189 Back     alignment and structure
>gi|253722212|pdb|1IDN|1 Chain 1, Mac-1 I Domain Metal Free Length = 190 Back     alignment and structure
>gi|31615654|pdb|1NA5|A Chain A, Integrin Alpha M I Domain Length = 197 Back     alignment and structure
>gi|31615583|pdb|1MF7|A Chain A, Integrin Alpha M I Domain Length = 194 Back     alignment and structure
>gi|157831557|pdb|1JLM|A Chain A, I-Domain From Integrin Cr3, Mn2+ Bound Length = 192 Back     alignment and structure
>gi|157831431|pdb|1IDO|A Chain A, I-Domain From Integrin Cr3, Mg2+ Bound Length = 189 Back     alignment and structure
>gi|22219356|pdb|1M1U|A Chain A, An Isoleucine-Based Allosteric Switch Controls Affinity And Shape Shifting In Integrin Cd11b A-Domain Length = 195 Back     alignment and structure
>gi|31615649|pdb|1N9Z|A Chain A, Integrin Alpha M I Domain Mutant Length = 192 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 von Willebrand factor type A [Candidatus Liberibacter a
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 1e-09
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 1e-08
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 8e-08
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 4e-07
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 9e-06
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 2e-05
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 5e-05
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 0.001
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 0.002
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
 Score = 59.5 bits (143), Expect = 1e-09
 Identities = 37/197 (18%), Positives = 80/197 (40%), Gaps = 19/197 (9%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN--IGIVGNQCTPLSNNLNEVKSR 265
               +  ESA  +V+ I         ++V +  I +     ++ +     S ++ EV S 
Sbjct: 25  NDFLIFKESASLMVDRIFSF-----EINVSVAIITFASEPKVLMSVLNDNSRDMTEVISS 79

Query: 266 LNKLNPYE-----NTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITDGENSGA 319
           L   N  +      TNTY A++  Y  + N+       T+    ++  +I +TDG+++  
Sbjct: 80  LENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMG 139

Query: 320 SAYQNTLNTLQICEYM---RNAGMKIYSVAVSAPPEGQDLLRKC---TDSSGQFFAVNDS 373
            + +  ++ ++    +   RN  + IY++ V         L +     D     F + D+
Sbjct: 140 GSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDT 199

Query: 374 RELLESFDKITDKIQEQ 390
           + L + F+ + D  +  
Sbjct: 200 KALHQVFEHMLDVSKLT 216


>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Length = 741 Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Length = 198 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Length = 194 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Length = 223 Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Length = 213 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202 Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Length = 200 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Length = 223 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 von Willebrand factor type A [Candidatus Liberibacter a
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 99.83
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 99.8
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 99.79
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 99.79
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold, mem 99.76
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 99.76
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 99.73
1atz_A189 VON willebrand factor; collagen-binding, hemostasis, di 99.7
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 99.69
3gxb_A184 VON willebrand factor; VWA-like fold, blood coagulation 99.69
3ibs_A218 Conserved hypothetical protein BATB; structural genomic 99.68
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 99.67
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 99.66
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; nucle 99.6
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1.30A { 99.48
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 99.37
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 99.32
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limbs, mi 99.2
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 99.75
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule, cel 99.14
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EGF dom 98.58
2vdr_B461 Integrin beta-3; cell adhesion/immune system, alternati 98.46
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, cell 97.71
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 98.18
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kD 97.77
1jey_B 565 KU80; double-strand DNA break repair, non-homologous EN 97.97
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
Probab=99.83  E-value=1.4e-19  Score=134.57  Aligned_cols=190  Identities=22%  Similarity=0.297  Sum_probs=132.4

Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             55654313575055666666766631012331023012688765403101343220112555333410002456655410
Q gi|254781108|r  144 ENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNS  223 (398)
Q Consensus       144 ~~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~  223 (398)
                      ..+.+|+++|||.|+||...                                             +....+.++..+++.
T Consensus         6 ~~g~~DivfvlD~SgSm~~~---------------------------------------------~~~~~k~~~~~~i~~   40 (509)
T 2odp_A            6 RSGHLNLYLLLDASQSVSEN---------------------------------------------DFLIFKESASLMVDR   40 (509)
T ss_dssp             SSSEEEEEEEEECSTTSCHH---------------------------------------------HHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHH
T ss_conf             78986599999786999989---------------------------------------------999999999999996


Q ss_pred             HHHCCCCCCCCCEEEEEEECCCCCCCCC--CCCCCCCHHHHHHHHHCCC-----CCCCCCHHHHHHHHHHHHCCCCCCC-
Q ss_conf             2202768776521346541267765431--1235689999999973577-----8887445889999999611346666-
Q gi|254781108|r  224 IQKAIQEKKNLSVRIGTIAYNIGIVGNQ--CTPLSNNLNEVKSRLNKLN-----PYENTNTYPAMHHAYRELYNEKESS-  295 (398)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~lt~~~~~~~~~I~~l~-----~~G~T~~~~gl~~a~~~l~~~~~~~-  295 (398)
                      +...+     ...+.+.+.|+.......  ....+.+...+..+|+.+.     ++|+|++..||..+++.+....... 
T Consensus        41 ~~~~~-----~~~rv~lv~fs~~~~~~~~l~~~~~~~~~~~~~~i~~i~~~~~~~~g~T~~~~Al~~a~~~~~~~~~~~~  115 (509)
T 2odp_A           41 IFSFE-----INVSVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLG  115 (509)
T ss_dssp             HHTTC-----CCEEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHTCCGGGGTTCCSCCHHHHHHHHHHHHHHHHHHHC
T ss_pred             HCCCC-----CCCEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             14489-----9748999998883579971788875579999999971734567789977799999999999998764302


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHH-----HHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCC---CE
Q ss_conf             6566766665169981588778777776631489999-----999978988999995479755899999851998---18
Q gi|254781108|r  296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC-----EYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG---QF  367 (398)
Q Consensus       296 ~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~~c-----~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~---~y  367 (398)
                      ......++.+|+|||||||+.|.+.......  ..+.     ..+++.||.||+||+|....+.+.|+.+|+.|+   |+
T Consensus       116 ~~~~~~~~~~~~iillTDG~~n~g~~~~~~~--~~~~~~~~~~~~~~~~v~i~~igvG~~~~d~~~L~~ias~~~~~~h~  193 (509)
T 2odp_A          116 METMAWQEIRHAIILLTDGKSNMGGSPKTAV--DHIREILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHA  193 (509)
T ss_dssp             TTSHHHHTEEEEEEEESCSCCCSSSCTHHHH--HHHHHHTTCCSTTGGGEEEEEEEESSSCCCHHHHHHHSCCCTTCCCE
T ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCHHHHH--HHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCEE
T ss_conf             3556667886299999488756699848999--99876666656630696599999588645899999986599997159


Q ss_pred             EEECCHHHHHHHHHHHHH
Q ss_conf             994698999999999999
Q gi|254781108|r  368 FAVNDSRELLESFDKITD  385 (398)
Q Consensus       368 y~a~~~~~L~~aF~~I~~  385 (398)
                      |.+.+.++|.++|++|-+
T Consensus       194 f~~~~~~~L~~~~~~i~~  211 (509)
T 2odp_A          194 FILQDTKALHQVFEHMLD  211 (509)
T ss_dssp             EEESSHHHHHHHHHHHEE
T ss_pred             EEECCHHHHHHHHHHCCC
T ss_conf             994888899999974044



>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3gxb_A VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for structural genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vdr_B Integrin beta-3; cell adhesion/immune system, alternative splicing, platelet integrin ALPHAIIBBETA3, polymorphism, glycoprotein, cell adhesion, calcium; HET: NAG MAN; 2.40A {Homo sapiens} PDB: 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 398 von Willebrand factor type A [Candidatus Liberibacter a
d1q0pa_209 c.62.1.1 (A:) Complement factor B domain {Human (Homo s 5e-05
d1mf7a_194 c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 0.001
d1pt6a_192 c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapien 0.001
d1n3ya_189 c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapie 0.003
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Complement factor B domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.7 bits (99), Expect = 5e-05
 Identities = 37/198 (18%), Positives = 68/198 (34%), Gaps = 19/198 (9%)

Query: 208 RKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLN 267
                  +S  NL+  +             + T A    I        S+N + V  +LN
Sbjct: 17  SNFTGAKKSLVNLIEKVA---SYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLN 73

Query: 268 KLNPYE-----NTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN------ 316
           ++N  +      TNT  A+   Y  +    +      G  R +  +I +TDG +      
Sbjct: 74  EINYEDHKLKSGTNTKKALQAVYSMMSWPDDV--PPEGWNRTRHVIILMTDGLHNMGGDP 131

Query: 317 -SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDL--LRKCTDSSGQFFAVNDS 373
            +     ++ L   +  +  R   + +Y   V       ++  L    D+    F V D 
Sbjct: 132 ITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDM 191

Query: 374 RELLESFDKITDKIQEQS 391
             L + F ++ D+ Q  S
Sbjct: 192 ENLEDVFYQMIDESQSLS 209


>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 von Willebrand factor type A [Candidatus Liberibacter a
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [TaxId 99.8
d1shux_181 Capillary morphogenesis protein 2 domain {Human (Homo s 99.77
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 960 99.77
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 960 99.74
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo sapi 99.73
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo sapi 99.73
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 96 99.72
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) 99.68
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated anti 99.61
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapiens) [T 99.3
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapiens) [T 99.1
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxId: 96 98.89
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed 98.65
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Complement factor B domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=2.5e-19  Score=131.58  Aligned_cols=191  Identities=21%  Similarity=0.238  Sum_probs=135.3

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             54313575055666666766631012331023012688765403101343220112555333410002456655410220
Q gi|254781108|r  147 AISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQK  226 (398)
Q Consensus       147 ~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~  226 (398)
                      .+|+++++|.||||...                                             +.+..+.++..+++.+..
T Consensus         1 slDivfvlD~SgSm~~~---------------------------------------------~~~~~k~~~~~li~~l~~   35 (209)
T d1q0pa_           1 SMNIYLVLDGSDSIGAS---------------------------------------------NFTGAKKSLVNLIEKVAS   35 (209)
T ss_dssp             CEEEEEEEECSTTTCHH---------------------------------------------HHHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHCCC
T ss_conf             90779999688998859---------------------------------------------999999999999996104


Q ss_pred             CCCCCCCCCEEEEEEECCCCCCCCC--CCCCCCCHHHHHHHHHCCC-----CCCCCCHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             2768776521346541267765431--1235689999999973577-----88874458899999996113466666566
Q gi|254781108|r  227 AIQEKKNLSVRIGTIAYNIGIVGNQ--CTPLSNNLNEVKSRLNKLN-----PYENTNTYPAMHHAYRELYNEKESSHNTI  299 (398)
Q Consensus       227 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~lt~~~~~~~~~I~~l~-----~~G~T~~~~gl~~a~~~l~~~~~~~~~~~  299 (398)
                      ..     ...+.+.+.|........  .....++...+...|+.+.     ++|+|++..||.++.+.+.........  
T Consensus        36 ~~-----~~~rv~lv~f~~~~~~~~~l~~~~~~~~~~l~~~i~~i~~~~~~~~g~t~~~~al~~a~~~~~~~~~~~~~--  108 (209)
T d1q0pa_          36 YG-----VKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPE--  108 (209)
T ss_dssp             TT-----CCCEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHTCCTTSCSCTTCCCHHHHHHHHHHHHCCTTSSCCT--
T ss_pred             CC-----CCCEEEEEEECCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC--
T ss_conf             78-----87679999965850588647651166789999999972101366788854989999999999752224765--


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCHHHHH-------HHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCC---CCEEE
Q ss_conf             7666651699815887787777766314899-------9999997898899999547975589999985199---81899
Q gi|254781108|r  300 GSTRLKKFVIFITDGENSGASAYQNTLNTLQ-------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSS---GQFFA  369 (398)
Q Consensus       300 ~~~~~~k~iillTDG~~~~~~~~~~~~~~~~-------~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~---~~yy~  369 (398)
                      ..++.+|++||+|||..+.+..+........       .+..++..||.||+||+|.+ .+...|+.+|+.+   ++||.
T Consensus       109 ~~~~~~kvvvl~TDG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~i~~vgvg~~-~~~~~L~~iAs~~~~~~~~f~  187 (209)
T d1q0pa_         109 GWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPL-VNQVNINALASKKDNEQHVFK  187 (209)
T ss_dssp             TGGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCSCBTTBCCGGGEEEEEEECSSC-CCHHHHHHHSCCCTTCCCEEE
T ss_pred             CCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCC-CCHHHHHHHHCCCCCCEEEEE
T ss_conf             6677751899975787667898589999999854437899999866995598427766-899999999749899715999


Q ss_pred             ECCHHHHHHHHHHHHHHHHHC
Q ss_conf             469899999999999987512
Q gi|254781108|r  370 VNDSRELLESFDKITDKIQEQ  390 (398)
Q Consensus       370 a~~~~~L~~aF~~I~~~i~~~  390 (398)
                      +.+.++|.++|++|.++..++
T Consensus       188 ~~~~~~L~~~~~~ii~~~~s~  208 (209)
T d1q0pa_         188 VKDMENLEDVFYQMIDESQSL  208 (209)
T ss_dssp             TTC-----------------C
T ss_pred             ECCHHHHHHHHHHHHHHHCCC
T ss_conf             389999999999998852578



>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 398 von Willebrand factor type A [Candidatus Liberibac
1jey_A_1-252252 (A:1-252) KU70; double-strand DNA break repair, no 1e-05
2ww8_A_221-279_318-447_506-585269 (A:221-279,A:318-447,A:506-585) RRGA, cell WALL su 9e-05
2ww8_A_221-279_318-447_506-585269 (A:221-279,A:318-447,A:506-585) RRGA, cell WALL su 7e-04
>1jey_A (A:1-252) KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}Length = 252 Back     alignment and structure
 Score = 45.4 bits (106), Expect = 1e-05
 Identities = 11/133 (8%), Positives = 38/133 (28%), Gaps = 19/133 (14%)

Query: 267 NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTL 326
           + +    + +    +        + +    +        K ++  T+ +N   +      
Sbjct: 133 DMMGHGSDYSLSEVLWVCANLFSDVQFKMSH--------KRIMLFTNEDNPHGNDSAKAS 184

Query: 327 NTLQICEYMRNAGMKIYSVAVSAPPEGQ------DLLRKCTDSSGQFFAVNDSRELLESF 380
                   +R+ G+ +  + +  P          D++    D   +      S       
Sbjct: 185 RARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESS-----KL 239

Query: 381 DKITDKIQEQSVR 393
           + +  K++ +  R
Sbjct: 240 EDLLRKVRAKETR 252


>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269 Back     alignment and structure
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 von Willebrand factor type A [Candidatus Liberibacter a
2ww8_A_221-279_318-447_506-585269 RRGA, cell WALL surface anchor family protein; IGG 99.96
3hrz_D_199-457259 Complement factor B; serine protease, glycosilated 99.8
3gxb_A_184 VON willebrand factor; VWA-like fold, blood coagul 99.75
1rrk_A_1-214214 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.75
2odp_A_1-224224 Complement C2; C3/C5 convertase, complement serine 99.72
1q0p_A_223 Complement factor B; VON willebrand factor, MAC-1, 99.7
1shu_X_182 Anthrax toxin receptor 2; alpha/beta rossmann fold 99.7
1ijb_A_202 VON willebrand factor; dinucleotide-binding fold, 99.69
1jey_A_1-252252 KU70; double-strand DNA break repair, non-homologo 99.64
3ibs_A_218 Conserved hypothetical protein BATB; structural ge 99.62
1atz_A_189 VON willebrand factor; collagen-binding, hemostasi 99.62
1pt6_A_213 Integrin alpha-1; X-RAY diffraction, cell adhesion 99.61
2b2x_A_223 Integrin alpha-1; computational design, antibody-a 99.6
1v7p_C_200 Integrin alpha-2; snake venom, C-type lectin, anta 99.59
1mjn_A_179 Integrin alpha-L; rossmann fold, immune system; 1. 99.55
1n3y_A_198 Integrin alpha-X; alpha/beta rossmann fold, cell a 99.53
1jey_B_1-236_463-505279 KU80; double-strand DNA break repair, non-homologo 99.51
1mf7_A_194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 99.5
3k6s_A_125-315191 Integrin alpha-X; hetero dimer, cell receptor, adh 99.49
2vdr_B_110-351242 Integrin beta-3; cell adhesion/immune system, alte 99.44
2iue_A_212 Pactolus I-domain; membrane protein, CD, ITC, limb 99.34
2nvo_A_53-64_359-535189 RO sixty-related protein, RSR; alpha helical repea 99.23
1yvr_A_365-538174 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 99.26
3fcs_B_109-352244 Integrin beta-3; beta propeller, rossmann fold, EG 99.13
3k6s_B_102-342241 Integrin beta-2; hetero dimer, cell receptor, adhe 99.13
3efo_B_171-421251 SEC24 related gene family, member D; copii, coat p 90.05
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
Probab=99.96  E-value=2.2e-29  Score=194.31  Aligned_cols=189  Identities=14%  Similarity=0.217  Sum_probs=141.9

Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             56543135750556666667666310123310230126887654031013432201125553334100024566554102
Q gi|254781108|r  145 NLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSI  224 (398)
Q Consensus       145 ~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~  224 (398)
                      +.++++++|||.|+||......                                       ...+++..+.+...++..+
T Consensus         2 ~~~~~i~~viD~S~SM~~~~~~---------------------------------------~~~~~~~~~~~~~~~~~~~   42 (269)
T 2ww8_A            2 SVPLDVVILLDNSNSMSNIRNK---------------------------------------NARRAERAGEATRSLIDKI   42 (269)
T ss_dssp             TCCEEEEEEEECCGGGCTTHHH---------------------------------------HCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCCCCCCCCC---------------------------------------CCEEEEECCCCEEEEEEEE
T ss_conf             2245579996146630001346---------------------------------------5305652264504642577


Q ss_pred             HHCCCCCCCCCEEEEEEECCCCCCCC------------CCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             20276877652134654126776543------------112356899999999735778887445889999999611346
Q gi|254781108|r  225 QKAIQEKKNLSVRIGTIAYNIGIVGN------------QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEK  292 (398)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~  292 (398)
                      ...+.      .+.+++.|.+.....            .+.+++.+...++..++.+.++|||+++.||+|+++.+.+.+
T Consensus        43 ~~~~~------~~v~lv~f~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~i~~~~~~GgT~~~~AL~~a~~~l~~~~  116 (269)
T 2ww8_A           43 TSDSE------NRVALVTYASTIDYSYLKLTNDKNDIVELKNKVPTEAEDHDGNRLMYQFGATFTQKALMKADEILTQQA  116 (269)
T ss_dssp             HTSTT------CEEEEEEESSSBBCCEEEEECCHHHHHHHHHHSCSCCCCSCTTSGGGGGCSCCHHHHHHHHHHHHHHHS
T ss_pred             EECCC------CEEEEEEECCCCCCCEEEEEECCCCEEEECCEEEEEECCCCCCCEEECCCCEEEEEECCCCCEEEEECC
T ss_conf             75378------605788402310420255541254113303101232102456410101462466530022414776215


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCCCCCCCCC-------------------------------------------------
Q ss_conf             6666566766665169981588778777776-------------------------------------------------
Q gi|254781108|r  293 ESSHNTIGSTRLKKFVIFITDGENSGASAYQ-------------------------------------------------  323 (398)
Q Consensus       293 ~~~~~~~~~~~~~k~iillTDG~~~~~~~~~-------------------------------------------------  323 (398)
                      +        ...+|+|||||||+.+......                                                 
T Consensus       117 ~--------~~~~kvIiliTDG~~~~~~~~~~~~~~~~~~~~v~i~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (269)
T 2ww8_A          117 R--------QNSQKVIFHITDGVPTMSYPINFNHATFAPSYQNQLNAFFSKSPNKDGILLSDFITQATSGEHTIVRGDGQ  188 (269)
T ss_dssp             C--------SSSEEEEEEEESSCCSEECCBCCCCSTTCCCHHHHHHHHHHTSTTSSSCCGGGBCCCCTTCGGGTCEECSS
T ss_pred             C--------CCCCEEEEECCCCCCCEEECCCCCCCCCCEEEECCCEEEEEECCCCCEEEECCEEEEECCCCCEEECCCCE
T ss_conf             7--------76520478615663100000134454100476313105665112112066111012310122102037742


Q ss_pred             -----------CCHHHHHHHHHHHHCCCEEEEEEECCCCC-------HHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHH
Q ss_conf             -----------63148999999997898899999547975-------589999985199818994698999999999999
Q gi|254781108|r  324 -----------NTLNTLQICEYMRNAGMKIYSVAVSAPPE-------GQDLLRKCTDSSGQFFAVNDSRELLESFDKITD  385 (398)
Q Consensus       324 -----------~~~~~~~~c~~~K~~gi~IytIg~~~~~~-------~~~~l~~cAs~~~~yy~a~~~~~L~~aF~~I~~  385 (398)
                                 .+..+..+|+.+|++||+||||||+.++.       ++++|++|||+|+|||+|++   |.++|++|++
T Consensus       189 ~~~~~~~~~~~~~~~~~~~c~~~k~~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~~---~~~~f~~ia~  265 (269)
T 2ww8_A          189 SNSNTAKITNHGDPTRWYYNGNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTD---TTKILEQLNR  265 (269)
T ss_dssp             CTCSSCCBCBSHHHHHHHHHHHTGGGCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEESS---GGGHHHHHHH
T ss_pred             ECCCCEEEEECCCCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEECC---CCCEECCCCC
T ss_conf             7532057620474305788752046763035776771564210023430577566116653264056---6511113355


Q ss_pred             HHHH
Q ss_conf             8751
Q gi|254781108|r  386 KIQE  389 (398)
Q Consensus       386 ~i~~  389 (398)
                      +|.+
T Consensus       266 ~~~~  269 (269)
T 2ww8_A          266 YFHT  269 (269)
T ss_dssp             HHTT
T ss_pred             CCEE
T ss_conf             4127



>3hrz_D (D:199-457) Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>3gxb_A (A:) VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1rrk_A (A:1-214) Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>2odp_A (A:1-224) Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>1q0p_A (A:) Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1shu_X (X:) Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} Back     alignment and structure