254781113

254781113

amino acid ABC transporter (permease)

GeneID in NCBI database:8210138Locus tag:CLIBASIA_05075
Protein GI in NCBI database:254781113Protein Accession:YP_003065526.1
Gene range:+(1115204, 1115884)Protein Length:226aa
Gene description:amino acid ABC transporter (permease)
COG prediction:[E] ABC-type amino acid transport system, permease component
KEGG prediction:amino acid ABC transporter (permease); K02029 polar amino acid transport system permease protein
SEED prediction:amino acid ABC transporter, permease protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED4 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVDK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHEEEHHHccccHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSiisipkgqwdasyaigltrkQTIRhiilpqtittsavplssEFISILKstsvastitIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIEssvtqhtysvdk
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPqtittsavplSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIessvtqhtysvdk
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYiseiirssiisiPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVDK
***EWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESS**********
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESS**********
*KYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQH******
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVDK
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVDK
MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVDK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target226 amino acid ABC transporter (permease) [Candidatus Liber
254780171398 ABC transporter membrane spanning protein (amino a 4e-17
254780172386 general L-amino acid transport system permease pro 2e-13
255764486493 ABC transporter, membrane spanning protein [Candid 5e-04
>gi|254780171|ref|YP_003064584.1| ABC transporter membrane spanning protein (amino acid) [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 79.7 bits (195), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 112/217 (51%), Gaps = 40/217 (18%)

Query: 12  SFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLL 71
           SFP L       T+      FV S ++G  +++     S        HF+    +  PLL
Sbjct: 177 SFPTL-------TMDTNAKIFVFSFVLGIVLSLFATRLSR-------HFHEKTGKALPLL 222

Query: 72  -VQLFVIFYGLPHIGIV-------FDS-----------------FVAIIISLTLNFSAYI 106
            +  F+IF GLP + ++       FD                  F+++ I+L+   +A+I
Sbjct: 223 YISTFLIF-GLPTLVLIALKYQLHFDKPVLGQFNFIGGSTVSPEFMSLYIALSCYTAAFI 281

Query: 107 SEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVA 166
           +EI+RS +I++P+GQ +A+ A+GLT ++  R ++LPQ + +   PL+S+++++LK++S+A
Sbjct: 282 AEIVRSGLIAVPRGQMEAAIALGLTHRKATRLVLLPQAMRSIIPPLTSQYLNLLKNSSLA 341

Query: 167 STITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILT 203
             +   ++      I++ T Q + I     F+YL L+
Sbjct: 342 VAVGFADLVSVGGTIINQTGQAIEIILIWMFIYLSLS 378

>gi|254780172|ref|YP_003064585.1| general L-amino acid transport system permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 386 Back     alignment
 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 92/165 (55%), Gaps = 18/165 (10%)

Query: 17  LYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHF---YVWIFRGTPLLVQ 73
           L+  ++VTL I+    +IS+ +G  +A+ R    ++ I ++ +    ++ +FRG PL+  
Sbjct: 173 LWGGLLVTLVISFFGIIISMPLGILLALGR----NSNIPVLRYACITFIELFRGVPLVTV 228

Query: 74  LFVIFYGLPHIGIVF-------DSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASY 126
           LF+    LP    +F       D  +  ++ ++   SAYI+E++R  + SI KGQ++A+ 
Sbjct: 229 LFMASIMLP----LFLPDTWDVDKLLRALLGVSAFASAYIAEVLRGGLQSISKGQFEAAN 284

Query: 127 AIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITI 171
           ++GL+  Q +R II+PQ I      + + FI + K +S+ S I +
Sbjct: 285 SLGLSYLQKMRLIIMPQVIKRVIPGIVNTFIGLFKDSSLISIINM 329

>gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Back     alignment
 Score = 36.2 bits (82), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 105 YISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTS 164
           Y+S +    I SIP+   D S  +G TR +T++++I P     +A P  +  I +  S +
Sbjct: 359 YVSSLSEDVISSIPRSLRDGSLGLGATRSETMKYVIFP-----AAFPGIAGAILMTASRT 413

Query: 165 VASTITIPEIFQTAQRIVSTTYQPL 189
           +  T+ +      A R+    ++ +
Sbjct: 414 IGETMIVVLAAGVAARLQFNPFESM 438

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target226 amino acid ABC transporter (permease) [Candidatus Liber
315122482239 amino acid ABC transporter (permease) [Candidatus Liber 1 5e-94
319781053226 polar amino acid ABC transporter inner membrane subunit 1 5e-63
260461455226 polar amino acid ABC transporter, inner membrane subuni 1 1e-62
13473305226 amino acid ABC transporter (permease) [Mesorhizobium lo 1 1e-61
288961662226 polar amino acid transport system permease protein [Azo 1 3e-61
187924662225 polar amino acid ABC transporter inner membrane subunit 1 2e-60
91784367225 ABC polar amino acid transporter, inner membrane subuni 1 2e-60
227823794245 putative amino acid ABC transporter, permease protein [ 1 3e-60
163857187226 putative amino-acid ABC transporter, permease protein [ 1 4e-60
150398331226 polar amino acid ABC transporter inner membrane subunit 1 5e-60
>gi|315122482|ref|YP_004062971.1| amino acid ABC transporter (permease) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 239 Back     alignment and organism information
 Score =  347 bits (891), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 174/225 (77%), Positives = 197/225 (87%), Gaps = 1/225 (0%)

Query: 1   MKYEWFNLIIDSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHF 60
           M  EWFN+ IDSFPQLLYAA  VTLPIA ISF+ S+I+G  I +IRI F   I S IMH 
Sbjct: 1   MNSEWFNVAIDSFPQLLYAAFFVTLPIALISFIPSIIVGLSITMIRICFPGKI-SFIMHL 59

Query: 61  YVWIFRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKG 120
           YVWIFRGTPLLVQLF+IFYGLPHIGIV D F AI+IS TLNFSAYISEIIRSSI+SIPKG
Sbjct: 60  YVWIFRGTPLLVQLFIIFYGLPHIGIVLDCFSAIVISFTLNFSAYISEIIRSSILSIPKG 119

Query: 121 QWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQR 180
           QWDA+Y+IGLTR+QTIRHIILPQ +  SA PLSSEFISILKSTS+AST+T+PEIFQTAQR
Sbjct: 120 QWDAAYSIGLTRQQTIRHIILPQIVVISAAPLSSEFISILKSTSLASTVTLPEIFQTAQR 179

Query: 181 IVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQHTYSVD 225
           IVSTTYQPLIIYCE+A +YLILTSFCYIIQ+KIES + ++TYS++
Sbjct: 180 IVSTTYQPLIIYCEIAIIYLILTSFCYIIQMKIESKLKKYTYSMN 224


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319781053|ref|YP_004140529.1| polar amino acid ABC transporter inner membrane subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 226 Back     alignment and organism information
>gi|260461455|ref|ZP_05809702.1| polar amino acid ABC transporter, inner membrane subunit [Mesorhizobium opportunistum WSM2075] Length = 226 Back     alignment and organism information
>gi|13473305|ref|NP_104872.1| amino acid ABC transporter (permease) [Mesorhizobium loti MAFF303099] Length = 226 Back     alignment and organism information
>gi|288961662|ref|YP_003451972.1| polar amino acid transport system permease protein [Azospirillum sp. B510] Length = 226 Back     alignment and organism information
>gi|187924662|ref|YP_001896304.1| polar amino acid ABC transporter inner membrane subunit [Burkholderia phytofirmans PsJN] Length = 225 Back     alignment and organism information
>gi|91784367|ref|YP_559573.1| ABC polar amino acid transporter, inner membrane subunit [Burkholderia xenovorans LB400] Length = 225 Back     alignment and organism information
>gi|227823794|ref|YP_002827767.1| putative amino acid ABC transporter, permease protein [Sinorhizobium fredii NGR234] Length = 245 Back     alignment and organism information
>gi|163857187|ref|YP_001631485.1| putative amino-acid ABC transporter, permease protein [Bordetella petrii DSM 12804] Length = 226 Back     alignment and organism information
>gi|150398331|ref|YP_001328798.1| polar amino acid ABC transporter inner membrane subunit [Sinorhizobium medicae WSM419] Length = 226 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target226 amino acid ABC transporter (permease) [Candidatus Liber
PRK15100220 PRK15100, PRK15100, amino acid ABC transporter permease 9e-48
COG4160228 COG4160, ArtM, ABC-type arginine/histidine transport sy 9e-37
TIGR03003212 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC tra 3e-30
COG4215230 COG4215, ArtQ, ABC-type arginine transport system, perm 2e-29
PRK09494219 PRK09494, glnP, glutamine ABC transporter permease prot 1e-25
TIGR03004214 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC tra 6e-25
PRK11122222 PRK11122, artM, arginine transporter permease subunit A 2e-22
PRK15069234 PRK15069, PRK15069, histidine/lysine/arginine/ornithine 5e-21
PRK15135228 PRK15135, PRK15135, histidine/lysine/arginine/ornithine 3e-18
PRK11123238 PRK11123, PRK11123, arginine transporter permease subun 9e-17
cd06261190 cd06261, TM_PBP2, Transmembrane subunit (TM) found in P 1e-11
COG2011222 COG2011, AbcD, ABC-type metal ion transport system, per 3e-05
COG0765222 COG0765, HisM, ABC-type amino acid transport system, pe 3e-44
TIGR0172699 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, 2e-17
COG0581292 COG0581, PstA, ABC-type phosphate transport system, per 5e-04
TIGR00974271 TIGR00974, 3a0107s02c, phosphate ABC transporter, perme 0.001
COG0573310 COG0573, PstC, ABC-type phosphate transport system, per 0.002
COG4597397 COG4597, BatB, ABC-type amino acid transport system, pe 6e-15
pfam00528183 pfam00528, BPD_transp_1, Binding-protein-dependent tran 3e-08
PRK15107224 PRK15107, PRK15107, glutamate/aspartate transport syste 9e-14
COG1173289 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel t 5e-04
COG1178540 COG1178, ThiP, ABC-type Fe3+ transport system, permease 0.004
PRK10782217 PRK10782, PRK10782, DL-methionine transporter permease 8e-04
COG0600258 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate t 0.001
COG0395281 COG0395, UgpE, ABC-type sugar transport system, permeas 0.001
COG4597397 COG4597, BatB, ABC-type amino acid transport system, pe 0.003
>gnl|CDD|185055 PRK15100, PRK15100, amino acid ABC transporter permease; Provisional Back     alignment and domain information
>gnl|CDD|33906 COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132048 TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC transporter, permease protein EhuD Back     alignment and domain information
>gnl|CDD|33942 COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181907 PRK09494, glnP, glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>gnl|CDD|132049 TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC transporter, permease protein EhuC Back     alignment and domain information
>gnl|CDD|182978 PRK11122, artM, arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>gnl|CDD|185029 PRK15069, PRK15069, histidine/lysine/arginine/ornithine ABC transporter permease HisM; Provisional Back     alignment and domain information
>gnl|CDD|185089 PRK15135, PRK15135, histidine/lysine/arginine/ornithine ABC transporter permease HisQ; Provisional Back     alignment and domain information
>gnl|CDD|182979 PRK11123, PRK11123, arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>gnl|CDD|119394 cd06261, TM_PBP2, Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>gnl|CDD|32194 COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31108 COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130787 TIGR01726, HEQRo_perm_3TM, amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family Back     alignment and domain information
>gnl|CDD|30926 COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162141 TIGR00974, 3a0107s02c, phosphate ABC transporter, permease protein PstA Back     alignment and domain information
>gnl|CDD|30918 COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34232 COG4597, BatB, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144205 pfam00528, BPD_transp_1, Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>gnl|CDD|185062 PRK15107, PRK15107, glutamate/aspartate transport system permease GltK; Provisional Back     alignment and domain information
>gnl|CDD|31366 COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31371 COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182726 PRK10782, PRK10782, DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|30945 COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30744 COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|34232 COG4597, BatB, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 226 amino acid ABC transporter (permease) [Candidatus Liber
PRK09494219 glnP glutamine ABC transporter permease protein; Review 100.0
COG0765222 HisM ABC-type amino acid transport system, permease com 100.0
PRK11123238 arginine transporter permease subunit ArtQ; Provisional 100.0
PRK11122222 artM arginine transporter permease subunit ArtM; Provis 100.0
TIGR03003218 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, pe 100.0
COG4160228 ArtM ABC-type arginine/histidine transport system, perm 100.0
COG4215230 ArtQ ABC-type arginine transport system, permease compo 100.0
TIGR03004216 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, pe 100.0
PRK10782217 DL-methionine transporter permease subunit; Provisional 100.0
COG4597397 BatB ABC-type amino acid transport system, permease com 100.0
COG2011222 AbcD ABC-type metal ion transport system, permease comp 99.98
PRK10971277 sulfate/thiosulfate transporter subunit; Provisional 99.95
TIGR03226312 PhnU 2-aminoethylphosphonate ABC transporter, permease 99.93
PRK09497285 potB spermidine/putrescine ABC transporter membrane pro 99.93
PRK11602291 cysW sulfate/thiosulfate transporter permease subunit; 99.93
PRK10592281 putrescine transporter subunit: membrane component of A 99.93
COG1177267 PotC ABC-type spermidine/putrescine transport system, p 99.93
COG0581292 PstA ABC-type phosphate transport system, permease comp 99.92
COG1174221 OpuBB ABC-type proline/glycine betaine transport system 99.92
PRK09500257 potC spermidine/putrescine ABC transporter membrane pro 99.92
PRK11275319 pstC phosphate transporter permease subunit; Provisiona 99.92
PRK09421229 modB molybdate ABC transporter permease protein; Review 99.91
PRK10160275 taurine transporter subunit; Provisional 99.91
COG0600258 TauC ABC-type nitrate/sulfonate/bicarbonate transport s 99.91
PRK10952354 glycine betaine transporter membrane protein; Provision 99.91
COG3639283 ABC-type phosphate/phosphonate transport system, permea 99.91
PRK11365263 ssuC alkanesulfonate transporter permease subunit; Prov 99.91
COG1178 540 ThiP ABC-type Fe3+ transport system, permease component 99.9
COG4176290 ProW ABC-type proline/glycine betaine transport system, 99.9
PRK10683317 putrescine transporter subunit: membrane component of A 99.9
TIGR03255272 PhnV 2-aminoethylphosphonate ABC transport system, memb 99.9
PRK11268292 pstA phosphate transporter permease subunit; Provisiona 99.89
PRK09433 536 thiP thiamine transporter membrane protein; Reviewed 99.89
COG0573310 PstC ABC-type phosphate transport system, permease comp 99.89
TIGR02138317 phosphate_pstC phosphate ABC transporter, permease prot 99.89
TIGR00974302 3a0107s02c phosphate ABC transporter, permease protein 99.89
TIGR03262 546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.88
TIGR03262546 PhnU2 putative 2-aminoethylphosphonate ABC transport sy 99.86
COG1175295 UgpA ABC-type sugar transport systems, permease compone 99.85
TIGR02139265 permease_CysT sulfate ABC transporter, permease protein 99.84
COG1173289 DppC ABC-type dipeptide/oligopeptide/nickel transport s 99.84
COG0555274 CysU ABC-type sulfate transport system, permease compon 99.84
PRK10561280 glycerol-3-phosphate transporter permease; Provisional 99.83
PRK10999520 malF maltose transporter membrane protein; Provisional 99.83
COG1176287 PotB ABC-type spermidine/putrescine transport system, p 99.82
COG4149225 ModC ABC-type molybdate transport system, permease comp 99.81
PRK09881296 ATP-dependent peptide transporter membrane subunit; Pro 99.81
TIGR01097192 3A0109s02M phosphonate ABC transporter, permease protei 99.8
PRK09433536 thiP thiamine transporter membrane protein; Reviewed 99.8
COG1178540 ThiP ABC-type Fe3+ transport system, permease component 99.8
PRK10417272 nikC nickel transporter permease NikC; Provisional 99.79
TIGR00969280 3a0106s02 sulfate ABC transporter, permease protein; In 99.79
PRK10913300 dipeptide transporter; Provisional 99.79
TIGR02141212 modB_ABC molybdate ABC transporter, permease protein; I 99.75
PRK10914339 dipeptide transporter permease DppB; Provisional 99.73
PRK10352314 nickel transporter permease NikB; Provisional 99.73
PRK09471306 oppB oligopeptide transporter permease; Reviewed 99.72
COG0601317 DppB ABC-type dipeptide/oligopeptide/nickel transport s 99.69
COG3833282 MalG ABC-type maltose transport systems, permease compo 99.67
TIGR02790258 nickel_nikC nickel ABC transporter, permease subunit Ni 99.64
COG4209309 LplB ABC-type polysaccharide transport system, permease 99.56
TIGR02140275 permease_CysW sulfate ABC transporter, permease protein 99.47
COG4239341 ABC-type uncharacterized transport system, permease com 99.44
TIGR02789315 nickel_nikB nickel ABC transporter, permease subunit Ni 99.44
COG4208287 CysW ABC-type sulfate transport system, permease compon 99.39
COG4132282 ABC-type uncharacterized transport system, permease com 99.27
COG4590733 ABC-type uncharacterized transport system, permease com 99.12
COG4662227 TupA ABC-type tungstate transport system, periplasmic c 99.02
TIGR01253 519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 98.82
TIGR01253519 thiP thiamine/thiamine pyrophosphate ABC transporter, p 98.47
COG4174364 ABC-type uncharacterized transport system, permease com 98.31
PRK10782217 DL-methionine transporter permease subunit; Provisional 95.77
TIGR03416267 ABC_choXWV_perm choline ABC transporter, permease prote 99.9
cd06261190 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic 99.87
CHL00187235 cysT sulfate transport protein; Provisional 99.82
TIGR01581226 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR0 99.82
COG0395281 UgpE ABC-type sugar transport system, permease componen 99.75
PRK10998296 malG maltose transporter permease; Provisional 99.7
PRK10973281 glycerol-3-phosphate transporter membrane protein; Prov 99.66
COG4168321 SapB ABC-type antimicrobial peptide transport system, p 98.72
COG4171296 SapC ABC-type antimicrobial peptide transport system, p 98.64
COG4986523 ABC-type anion transport system, duplicated permease co 98.54
TIGR01183203 ntrB nitrate ABC transporter, permease protein; InterPr 98.53
COG4135551 ABC-type uncharacterized transport system, permease com 98.47
pfam03649250 UPF0014 Uncharacterized protein family (UPF0014). 97.23
TIGR0172699 HEQRo_perm_3TM amino acid ABC transporter, permease pro 99.89
pfam00528183 BPD_transp_1 Binding-protein-dependent transport system 99.84
COG4986 523 ABC-type anion transport system, duplicated permease co 99.12
COG4135 551 ABC-type uncharacterized transport system, permease com 95.25
PRK10592281 putrescine transporter subunit: membrane component of A 94.49
COG0390256 ABC-type uncharacterized transport system, permease com 93.6
>PRK09494 glnP glutamine ABC transporter permease protein; Reviewed Back     alignment and domain information
>COG0765 HisM ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11123 arginine transporter permease subunit ArtQ; Provisional Back     alignment and domain information
>PRK11122 artM arginine transporter permease subunit ArtM; Provisional Back     alignment and domain information
>TIGR03003 ectoine_ehuD ectoine/hydroxyectoine ABC transporter, permease protein EhuD; InterPro: IPR014341 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4160 ArtM ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4215 ArtQ ABC-type arginine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03004 ectoine_ehuC ectoine/hydroxyectoine ABC transporter, permease protein EhuC; InterPro: IPR014342 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>COG4597 BatB ABC-type amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2011 AbcD ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10971 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03226 PhnU 2-aminoethylphosphonate ABC transporter, permease protein Back     alignment and domain information
>PRK09497 potB spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK11602 cysW sulfate/thiosulfate transporter permease subunit; Provisional Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG1177 PotC ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism] Back     alignment and domain information
>COG0581 PstA ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1174 OpuBB ABC-type proline/glycine betaine transport systems, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09500 potC spermidine/putrescine ABC transporter membrane protein; Reviewed Back     alignment and domain information
>PRK11275 pstC phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09421 modB molybdate ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK10160 taurine transporter subunit; Provisional Back     alignment and domain information
>COG0600 TauC ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10952 glycine betaine transporter membrane protein; Provisional Back     alignment and domain information
>COG3639 ABC-type phosphate/phosphonate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11365 ssuC alkanesulfonate transporter permease subunit; Provisional Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4176 ProW ABC-type proline/glycine betaine transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10683 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>TIGR03255 PhnV 2-aminoethylphosphonate ABC transport system, membrane component PhnV Back     alignment and domain information
>PRK11268 pstA phosphate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG0573 PstC ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02138 phosphate_pstC phosphate ABC transporter, permease protein PstC; InterPro: IPR011864 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00974 3a0107s02c phosphate ABC transporter, permease protein PstA; InterPro: IPR005672 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>TIGR03262 PhnU2 putative 2-aminoethylphosphonate ABC transport system, permease protein Back     alignment and domain information
>COG1175 UgpA ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02139 permease_CysT sulfate ABC transporter, permease protein CysT; InterPro: IPR011865 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1173 DppC ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0555 CysU ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10561 glycerol-3-phosphate transporter permease; Provisional Back     alignment and domain information
>PRK10999 malF maltose transporter membrane protein; Provisional Back     alignment and domain information
>COG1176 PotB ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism] Back     alignment and domain information
>COG4149 ModC ABC-type molybdate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09881 ATP-dependent peptide transporter membrane subunit; Provisional Back     alignment and domain information
>TIGR01097 3A0109s02M phosphonate ABC transporter, permease protein; InterPro: IPR005769 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK09433 thiP thiamine transporter membrane protein; Reviewed Back     alignment and domain information
>COG1178 ThiP ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10417 nikC nickel transporter permease NikC; Provisional Back     alignment and domain information
>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system Back     alignment and domain information
>PRK10913 dipeptide transporter; Provisional Back     alignment and domain information
>TIGR02141 modB_ABC molybdate ABC transporter, permease protein; InterPro: IPR011867 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10914 dipeptide transporter permease DppB; Provisional Back     alignment and domain information
>PRK10352 nickel transporter permease NikB; Provisional Back     alignment and domain information
>PRK09471 oppB oligopeptide transporter permease; Reviewed Back     alignment and domain information
>COG0601 DppB ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3833 MalG ABC-type maltose transport systems, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02790 nickel_nikC nickel ABC transporter, permease subunit NikC; InterPro: IPR014157 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02140 permease_CysW sulfate ABC transporter, permease protein CysW; InterPro: IPR011866 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4239 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02789 nickel_nikB nickel ABC transporter, permease subunit NikB; InterPro: IPR014156 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4208 CysW ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4132 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR01253 thiP thiamine/thiamine pyrophosphate ABC transporter, permease protein; InterPro: IPR005947 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK10782 DL-methionine transporter permease subunit; Provisional Back     alignment and domain information
>TIGR03416 ABC_choXWV_perm choline ABC transporter, permease protein Back     alignment and domain information
>cd06261 TM_PBP2 Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs Back     alignment and domain information
>CHL00187 cysT sulfate transport protein; Provisional Back     alignment and domain information
>TIGR01581 Mo_ABC_porter NifC-like ABC-type porter; InterPro: IPR006469 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0395 UgpE ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10998 malG maltose transporter permease; Provisional Back     alignment and domain information
>PRK10973 glycerol-3-phosphate transporter membrane protein; Provisional Back     alignment and domain information
>COG4168 SapB ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4171 SapC ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01183 ntrB nitrate ABC transporter, permease protein; InterPro: IPR005889 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014) Back     alignment and domain information
>TIGR01726 HEQRo_perm_3TM amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family; InterPro: IPR010065 This entry represents one of several classes of multiple membrane spanning regions found in the inner membrane component of binding-protein-dependent transport systems Back     alignment and domain information
>pfam00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component Back     alignment and domain information
>COG4986 ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4135 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK10592 putrescine transporter subunit: membrane component of ABC superfamily; Provisional Back     alignment and domain information
>COG0390 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target226 amino acid ABC transporter (permease) [Candidatus Liber
3dhw_A217 D-methionine transport system permease protein METI; AB 1e-11
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 2e-07
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Length = 217 Back     alignment and structure
 Score = 65.2 bits (158), Expect = 1e-11
 Identities = 36/205 (17%), Positives = 85/205 (41%), Gaps = 6/205 (2%)

Query: 11  DSFPQLLYAAIVVTLPIACISFVISLIIGFFIAVI------RIFFSDTIISLIMHFYVWI 64
           +    LL   +  TL +  +S     +IG  + V+          ++  +   +   V I
Sbjct: 3   EPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNI 62

Query: 65  FRGTPLLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDA 124
           FR  P ++ L  +      I        A I+ LT+  + +I+ ++ ++++ IP G  +A
Sbjct: 63  FRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEA 122

Query: 125 SYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVST 184
           S A+G T  Q +R ++LP+ +       +   I+++  +++   +    + Q   +    
Sbjct: 123 SRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYI 182

Query: 185 TYQPLIIYCELAFVYLILTSFCYII 209
            Y   ++   L  + +++    +  
Sbjct: 183 GYNATVMNTVLVLLVILVYLIQFAG 207


>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Length = 295 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target226 amino acid ABC transporter (permease) [Candidatus Liber
3dhw_A217 D-methionine transport system permease protein METI; AB 100.0
3d31_C295 Sulfate/molybdate ABC transporter, permease protein; AT 99.96
2onk_C284 Molybdate/tungstate ABC transporter, permease protein; 99.93
2r6g_F514 Maltose transport system permease protein MALF; ABC tra 99.87
2r6g_G296 Maltose transport system permease protein MALG; ABC tra 99.79
>3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Back     alignment and structure
Probab=100.00  E-value=5.1e-33  Score=198.85  Aligned_cols=207  Identities=19%  Similarity=0.288  Sum_probs=166.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999999999999999999999970------67637999999999998555322222211122333210
Q gi|254781113|r   13 FPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIF------FSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGI   86 (226)
Q Consensus        13 ~~~~l~~~l~~Tl~~~~~~~~i~~~lg~~la~~~~~------~~~~~~~~~~~~~i~~~r~iP~lv~l~~~~f~~~~~g~   86 (226)
                      .-.++++++++|+.+++.+++++.++|+++|+....      ..+++.......++.+++++|.+++++......+....
T Consensus         5 ~~~l~l~~~~~Tl~~a~~~~~~~~~ig~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~~~~   84 (217)
T 3dhw_A            5 MMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVG   84 (217)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999986444320089999999999999999999999999999999986


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             14433333310011000001578999887528336899865174635657787522357644567787889875267999
Q gi|254781113|r   87 VFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVA  166 (226)
Q Consensus        87 ~~~~~~~~ii~l~l~~~~~~~~i~r~~l~~v~~~~~EAA~alG~s~~q~~~~iilPqal~~ilp~l~~~~i~lik~tsl~  166 (226)
                      ...++..+++++++...||+.+.++++++++|++++||||++|+|+||++|||++||++|.+++++.+.++..++++++.
T Consensus        85 ~~~~~~~~ii~~~~~~~~~~~~~~~~~l~~i~~~~~eAA~~lGas~~q~f~~vilP~~~p~ii~~~~~~~~~~i~~~~i~  164 (217)
T 3dhw_A           85 TSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMG  164 (217)
T ss_dssp             CSSSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             12369999999999867999999999998589899999871898989996974199789999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             997699999999999832357799999999999999999999999999986213
Q gi|254781113|r  167 STITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQH  220 (226)
Q Consensus       167 s~ig~~el~~~a~~i~~~~~~~~~~~~~~~~i~l~i~~~~~~l~~~lerr~~~~  220 (226)
                      +.+|.+++.....+.....++. +......+++.+++.....+.++++||++||
T Consensus       165 ~~ig~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~~~~rR  217 (217)
T 3dhw_A          165 GAVGAGGLGQIGYQYGYIGYNA-TVMNTVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             CSTTCCHHHHHHHHHHHSSCCT-THHHHHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9998879999999999986008-9999999999999999999999999975699



>3d31_C Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: f.58.1.1 Back     alignment and structure
>2onk_C Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: f.58.1.1 Back     alignment and structure
>2r6g_F Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: e.70.1.1 f.58.1.1 PDB: 3fh6_F Back     alignment and structure
>2r6g_G Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} SCOP: f.58.1.1 PDB: 3fh6_G Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 226 amino acid ABC transporter (permease) [Candidatus Liber
d3dhwa1203 f.58.1.1 (A:6-208) D-methionine transport system permea 4e-12
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Length = 203 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
 Score = 65.1 bits (158), Expect = 4e-12
 Identities = 36/199 (18%), Positives = 84/199 (42%), Gaps = 6/199 (3%)

Query: 16  LLYAAIVVTLPIACISFVISLIIGFFIAVI------RIFFSDTIISLIMHFYVWIFRGTP 69
           LL   +  TL +  +S     +IG  + V+          ++  +   +   V IFR  P
Sbjct: 3   LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIP 62

Query: 70  LLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIG 129
            ++ L  +      I        A I+ LT+  + +I+ ++ ++++ IP G  +AS A+G
Sbjct: 63  FIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMG 122

Query: 130 LTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPL 189
            T  Q +R ++LP+ +       +   I+++  +++   +    + Q   +     Y   
Sbjct: 123 ATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNAT 182

Query: 190 IIYCELAFVYLILTSFCYI 208
           ++   L  + +++    + 
Sbjct: 183 VMNTVLVLLVILVYLIQFA 201


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target226 amino acid ABC transporter (permease) [Candidatus Liber
d3dhwa1203 D-methionine transport system permease protein MetI {Es 99.96
d2onkc1252 Molybdate/tungstate transport system permease protein W 99.91
d3d31c1248 Sulfate/molybdate ABC transporter, permease protein {Me 99.91
d2r6gf2244 Maltose transport system permease protein MalF {Escheri 99.82
d2r6gg1290 Maltose transport system permease protein MalG {Escheri 99.82
>d3dhwa1 f.58.1.1 (A:6-208) D-methionine transport system permease protein MetI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MetI-like
superfamily: MetI-like
family: MetI-like
domain: D-methionine transport system permease protein MetI
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=6.1e-30  Score=180.64  Aligned_cols=192  Identities=20%  Similarity=0.311  Sum_probs=154.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999999999999999999999999999999970------67637999999999998555322222211122333210144
Q gi|254781113|r   16 LLYAAIVVTLPIACISFVISLIIGFFIAVIRIF------FSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGIVFD   89 (226)
Q Consensus        16 ~l~~~l~~Tl~~~~~~~~i~~~lg~~la~~~~~------~~~~~~~~~~~~~i~~~r~iP~lv~l~~~~f~~~~~g~~~~   89 (226)
                      ++++++++|+.+++.+++++.++|+++|+....      .+++........++++++++|..+++++.+...........
T Consensus         3 lll~~~~~tl~is~~~~~i~~ilg~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~~v~~~~~~~~~~~~~~~~~   82 (203)
T d3dhwa1           3 LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSI   82 (203)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTCCSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             89999999999999999999999999999999987444320089999999999999999999999999986355404541


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33333310011000001578999887528336899865174635657787522357644567787889875267999997
Q gi|254781113|r   90 SFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTI  169 (226)
Q Consensus        90 ~~~~~ii~l~l~~~~~~~~i~r~~l~~v~~~~~EAA~alG~s~~q~~~~iilPqal~~ilp~l~~~~i~lik~tsl~s~i  169 (226)
                      ++.++++++++++.||+.+.++++++++|++|+||||++|+|+||++|||++||+.|.++++..++++..+++++++..+
T Consensus        83 ~~~~~i~~~~~~~~p~~~~~~~~~l~~i~~~~~Eaa~~lGas~~q~~~~vilP~~~p~i~~~~~~~~~~~i~~~~~~~~i  162 (203)
T d3dhwa1          83 GLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAV  162 (203)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHCCST
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             19999999999864899999998888436206899988699444241884099769999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             699999999999832357799999999999999999999
Q gi|254781113|r  170 TIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYI  208 (226)
Q Consensus       170 g~~el~~~a~~i~~~~~~~~~~~~~~~~i~l~i~~~~~~  208 (226)
                      |.+++....++.+...+++.......... +++....++
T Consensus       163 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~i~v~li~~  200 (203)
T d3dhwa1         163 GAGGLGQIGYQYGYIGYNATVMNTVLVLL-VILVYLIQF  200 (203)
T ss_dssp             TCCHHHHHHHHHHHSSCCTTHHHHHHHHH-HHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHHHH-HHHHHHHHH
T ss_conf             77599999999998740289999999999-999999999



>d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31c1 f.58.1.1 (C:13-260) Sulfate/molybdate ABC transporter, permease protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2r6gf2 f.58.1.1 (F:261-504) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r6gg1 f.58.1.1 (G:7-296) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 226 amino acid ABC transporter (permease) [Candidatus
3dhw_A_217 (A:) D-methionine transport system permease protei 2e-17
3d31_C_295 (C:) Sulfate/molybdate ABC transporter, permease p 7e-09
2r6g_F_269-326_360-453152 (F:269-326,F:360-453) Maltose transport system per 3e-10
2onk_C_69-249181 (C:69-249) Molybdate/tungstate ABC transporter, pe 7e-07
2r6g_G_73-244172 (G:73-244) Maltose transport system permease prote 1e-04
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12}Length = 217 Back     alignment and structure
 Score = 83.9 bits (207), Expect = 2e-17
 Identities = 36/200 (18%), Positives = 84/200 (42%), Gaps = 6/200 (3%)

Query: 16  LLYAAIVVTLPIACISFVISLIIGFFIAVI------RIFFSDTIISLIMHFYVWIFRGTP 69
           LL   +  TL +  +S     +IG  + V+          ++  +   +   V IFR  P
Sbjct: 8   LLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIP 67

Query: 70  LLVQLFVIFYGLPHIGIVFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIG 129
            ++ L  +      I        A I+ LT+  + +I+ ++ ++++ IP G  +AS A+G
Sbjct: 68  FIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMG 127

Query: 130 LTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTITIPEIFQTAQRIVSTTYQPL 189
            T  Q +R ++LP+ +       +   I+++  +++   +    + Q   +     Y   
Sbjct: 128 ATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYGYIGYNAT 187

Query: 190 IIYCELAFVYLILTSFCYII 209
           ++   L  + +++    +  
Sbjct: 188 VMNTVLVLLVILVYLIQFAG 207


>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans}Length = 295 Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 152 Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus}Length = 181 Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12}Length = 172 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target226 amino acid ABC transporter (permease) [Candidatus Liber
3dhw_A_217 D-methionine transport system permease protein MET 99.97
3d31_C_295 Sulfate/molybdate ABC transporter, permease protei 99.95
2onk_C_69-249181 Molybdate/tungstate ABC transporter, permease prot 99.89
2r6g_G_73-244172 Maltose transport system permease protein MALG; AB 99.85
2r6g_F_269-326_360-453152 Maltose transport system permease protein MALF; AB 99.84
3dhw_A_217 D-methionine transport system permease protein MET 93.42
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure
Probab=99.97  E-value=1.3e-31  Score=192.03  Aligned_cols=207  Identities=19%  Similarity=0.286  Sum_probs=173.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999999999999999999999706------7637999999999998555322222211122333210
Q gi|254781113|r   13 FPQLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFF------SDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGI   86 (226)
Q Consensus        13 ~~~~l~~~l~~Tl~~~~~~~~i~~~lg~~la~~~~~~------~~~~~~~~~~~~i~~~r~iP~lv~l~~~~f~~~~~g~   86 (226)
                      ..+.+++++++|+.+++.++++++++|+++|+...+.      ..+.+........+.++++|.++.+...+...+..+.
T Consensus         5 ~~~~l~~~l~~tl~~~~~~~~i~~vig~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (217)
T 3dhw_A            5 MMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVG   84 (217)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTCSSSCCSSHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999987344320189999999999999999999999999986455204


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             14433333310011000001578999887528336899865174635657787522357644567787889875267999
Q gi|254781113|r   87 VFDSFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVA  166 (226)
Q Consensus        87 ~~~~~~~~ii~l~l~~~~~~~~i~r~~l~~v~~~~~EAA~alG~s~~q~~~~iilPqal~~ilp~l~~~~i~lik~tsl~  166 (226)
                      ...++.+.++++++...||+.++.|++++++|++++|||+++|+|+||++|||++||++|.+++++.+.+...+++++.+
T Consensus        85 ~~~~~~~~ii~~~~~~~~~i~~~~~~~l~~i~~~~~eaA~~lG~s~~q~~~~v~lP~~~p~i~~~~~~~~~~~~~~~~~~  164 (217)
T 3dhw_A           85 TSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMG  164 (217)
T ss_dssp             CSSSHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             53018899898899724689899998888615027788860698742142673099769999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             997699999999999832357799999999999999999999999999986213
Q gi|254781113|r  167 STITIPEIFQTAQRIVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESSVTQH  220 (226)
Q Consensus       167 s~ig~~el~~~a~~i~~~~~~~~~~~~~~~~i~l~i~~~~~~l~~~lerr~~~~  220 (226)
                      +.+|.++....+++....++++...+ ..+++..++...+..+.++++||++||
T Consensus       165 ~~ig~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~i~~~~~~~l~~~l~~~~~rR  217 (217)
T 3dhw_A          165 GAVGAGGLGQIGYQYGYIGYNATVMN-TVLVLLVILVYLIQFAGDRIVRAVTRK  217 (217)
T ss_dssp             CSTTCCHHHHHHHHHHHSSCCTTHHH-HHHHHHHHHHHHHHHHCC---------
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99987599999999999750189999-999999999999999999999985699



>3d31_C (C:) Sulfate/molybdate ABC transporter, permease protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} Back     alignment and structure
>2onk_C (C:69-249) Molybdate/tungstate ABC transporter, permease protein; membrane protein; 3.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2r6g_G (G:73-244) Maltose transport system permease protein MALG; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>2r6g_F (F:269-326,F:360-453) Maltose transport system permease protein MALF; ABC transporter, catalytic intermediate, E. coli maltose transporter, MBP; HET: MAL ATP; 2.80A {Escherichia coli K12} Back     alignment and structure
>3dhw_A (A:) D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} Back     alignment and structure