254781114

254781114

glycosyl transferase family protein

GeneID in NCBI database:8210139Locus tag:CLIBASIA_05080
Protein GI in NCBI database:254781114Protein Accession:YP_003065527.1
Gene range:+(1115996, 1116787)Protein Length:263aa
Gene description:glycosyl transferase family protein
COG prediction:[M] Glycosyltransferase involved in LPS biosynthesis
KEGG prediction:glycosyl transferase family protein; K07270 glycosyl transferase, family 25
SEED prediction:Beta-1,4-galactosyltransferase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPSSSSSLIKS
cccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEcHHHHHHHHHHHcccccccEEEEccccccccccccEEEcccccEEEEEccccccEEEEEEcHHHHHHHHHHHccccccHHHHHHHHHHccccEEEEEccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHcc
cccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHccccccEEEEEEcccccccccccEcccccEEEEcccccccccEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEccEEccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccc
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDaiygennpicnrifSHQKRQCQFKRllslpeigcyishihlwkriayspaigaiileddadfsdefsqllphlskcdinnILIKFDalrkkpkkdsylctlpgnfdihqprilsprttgyfigKEAAIHLLNVRKniyrpidmdmkhwwehnipslvtepgavyeaidtndstieesrlvrkptfsplyfyrnTCYQWNLHynawrkdlppvsttkflpsssssliks
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTlpgnfdihqprilSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDtndstieesrlvrkptfspLYFYRNTCYQWNLHYNAWRKDLppvsttkflpsssssliks
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPsssssLIKS
*PIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAID******************PLYFYRNTCYQWNLHYNAWRKD********************
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTT*************
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTK************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPSSSSSLIKS
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPSSSSSLIKS
MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKDLPPVSTTKFLPSSSSSLIKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target263 glycosyl transferase family protein [Candidatus Liberib
315122483253 glycosyl transferase family protein [Candidatus Liberib 1 1e-105
241765554244 glycosyl transferase family 25 [Acidovorax delafieldii 1 3e-17
91791576256 glycosyl transferase family protein [Shewanella denitri 1 4e-15
315633563225 LPS biosynthesis protein [Aggregatibacter segnis ATCC 3 1 6e-14
284105044248 Glycosyl transferase, family 25 [Candidatus Poribacteri 1 2e-13
226192533247 Lex2B [Haemophilus influenzae] Length = 247 1 4e-13
226192539247 Lex2B [Haemophilus influenzae] Length = 247 1 8e-13
145636691247 UDP-glucose--lipooligosaccharide glucosyltransferase [H 1 1e-12
20977179248 Lex2B [Haemophilus influenzae] Length = 248 1 1e-12
311766115247 UDP-glucose--lipooligosaccharide glucosyltransferase [H 1 1e-12
>gi|315122483|ref|YP_004062972.1| glycosyl transferase family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 253 Back     alignment and organism information
 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/252 (73%), Positives = 212/252 (84%)

Query: 1   MPIPVYVISLPFSHARREKFCHRAARIHLQFSFFDAIYGENNPICNRIFSHQKRQCQFKR 60
           + I  YVISLPFSHARREKFCHRA+ I+LQFSF DAIYGEN+ IC +IF +Q RQ  FKR
Sbjct: 2   ISISNYVISLPFSHARREKFCHRASLINLQFSFVDAIYGENDSICKKIFYNQNRQHHFKR 61

Query: 61  LLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKF 120
           LLSLPEIGCY+SHI+LWK+IA S A+GAIILEDDADFS  F QL+ HL+ CDI NILIKF
Sbjct: 62  LLSLPEIGCYMSHINLWKKIASSDALGAIILEDDADFSVGFPQLISHLNHCDIGNILIKF 121

Query: 121 DALRKKPKKDSYLCTLPGNFDIHQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDM 180
           DALRK+PK+  +LC +PGNF I QPRILSPRTTGYFIGK+AA HLL+VRK+I+RP+DMDM
Sbjct: 122 DALRKRPKETDFLCKVPGNFGILQPRILSPRTTGYFIGKQAAAHLLDVRKDIFRPVDMDM 181

Query: 181 KHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAW 240
           KHWWEH +PSLVTEPGAVYEA +T+DS+IE SRL +K TFSPLYFY+N  YQ NLHY A 
Sbjct: 182 KHWWEHTVPSLVTEPGAVYEAANTDDSSIEASRLQKKRTFSPLYFYQNMRYQLNLHYQAR 241

Query: 241 RKDLPPVSTTKF 252
           +K LP VS   F
Sbjct: 242 KKTLPYVSPEIF 253


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241765554|ref|ZP_04763514.1| glycosyl transferase family 25 [Acidovorax delafieldii 2AN] Length = 244 Back     alignment and organism information
>gi|91791576|ref|YP_561227.1| glycosyl transferase family protein [Shewanella denitrificans OS217] Length = 256 Back     alignment and organism information
>gi|315633563|ref|ZP_07888853.1| LPS biosynthesis protein [Aggregatibacter segnis ATCC 33393] Length = 225 Back     alignment and organism information
>gi|284105044|ref|ZP_06386173.1| Glycosyl transferase, family 25 [Candidatus Poribacteria sp. WGA-A3] Length = 248 Back     alignment and organism information
>gi|226192533|gb|ACO37547.1| Lex2B [Haemophilus influenzae] Length = 247 Back     alignment and organism information
>gi|226192539|gb|ACO37551.1| Lex2B [Haemophilus influenzae] Length = 247 Back     alignment and organism information
>gi|145636691|ref|ZP_01792358.1| UDP-glucose--lipooligosaccharide glucosyltransferase [Haemophilus influenzae PittHH] Length = 247 Back     alignment and organism information
>gi|20977179|gb|AAM33309.1|AF503507_2 Lex2B [Haemophilus influenzae] Length = 248 Back     alignment and organism information
>gi|311766115|emb|CBW29072.1| UDP-glucose--lipooligosaccharide glucosyltransferase [Haemophilus influenzae 10810] Length = 247 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target263 glycosyl transferase family protein [Candidatus Liberib
cd06532128 cd06532, Glyco_transf_25, Glycosyltransferase family 25 1e-20
KOG4179568 KOG4179, KOG4179, KOG4179, Lysyl hydrolase/glycosyltran 6e-04
pfam01755200 pfam01755, Glyco_transf_25, Glycosyltransferase family 6e-22
COG3306255 COG3306, COG3306, Glycosyltransferase involved in LPS b 1e-15
>gnl|CDD|133474 cd06532, Glyco_transf_25, Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis Back     alignment and domain information
>gnl|CDD|39381 KOG4179, KOG4179, KOG4179, Lysyl hydrolase/glycosyltransferase family 25 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|110732 pfam01755, Glyco_transf_25, Glycosyltransferase family 25 (LPS biosynthesis protein) Back     alignment and domain information
>gnl|CDD|33115 COG3306, COG3306, Glycosyltransferase involved in LPS biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 263 glycosyl transferase family protein [Candidatus Liberib
pfam01755200 Glyco_transf_25 Glycosyltransferase family 25 (LPS bios 100.0
cd06532128 Glyco_transf_25 Glycosyltransferase family 25 [lipoolig 100.0
KOG4179568 consensus 100.0
pfam02434248 Fringe Fringe-like. The drosophila protein fringe (FNG) 97.57
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essenti 93.49
pfam03071434 GNT-I GNT-I family. Alpha-1,3-mannosyl-glycoprotein bet 92.55
KOG2287349 consensus 90.22
COG3306255 Glycosyltransferase involved in LPS biosynthesis [Cell 100.0
pfam03213325 Pox_P35 Poxvirus P35 protein. 98.15
pfam01762196 Galactosyl_T Galactosyltransferase. This family include 93.01
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transfe 93.13
>pfam01755 Glyco_transf_25 Glycosyltransferase family 25 (LPS biosynthesis protein) Back     alignment and domain information
>cd06532 Glyco_transf_25 Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis Back     alignment and domain information
>KOG4179 consensus Back     alignment and domain information
>pfam02434 Fringe Fringe-like Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>pfam03071 GNT-I GNT-I family Back     alignment and domain information
>KOG2287 consensus Back     alignment and domain information
>COG3306 Glycosyltransferase involved in LPS biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03213 Pox_P35 Poxvirus P35 protein Back     alignment and domain information
>pfam01762 Galactosyl_T Galactosyltransferase Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 glycosyl transferase family protein [Candidatus Liberib
1fo8_A343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylgluco 97.93
2j0a_A280 Beta-1,3-N-acetylglucosaminyltransferase manic fringe; 97.24
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
Probab=97.93  E-value=0.00083  Score=39.82  Aligned_cols=189  Identities=12%  Similarity=0.042  Sum_probs=95.2

Q ss_pred             CC-CCEEEEECCCCHHHHHHHHHHHHHC-CC-CEEEEECCCCCCCCHHHH--HHCCHHC------CCCCCCCCCHHHHHH
Q ss_conf             98-8689980899889999999999877-99-789996637352896774--2020000------246788788789999
Q gi|254781114|r    1 MP-IPVYVISLPFSHARREKFCHRAARI-HL-QFSFFDAIYGENNPICNR--IFSHQKR------QCQFKRLLSLPEIGC   69 (263)
Q Consensus         1 m~-~kiyvInL~~~~~Rr~~~~~~~~~~-gi-~~e~~~Avdg~~~~~~~~--~~~~~~~------~~~~~~~l~~geigC   69 (263)
                      |+ +||-||.-.|- +=+..+...++.. +. ++..+=..||......+.  .+.....      ...........+.+|
T Consensus         1 ~~viPVlvia~NRp-~l~r~L~sLlk~~p~~~~~~LiVs~DG~~~~~~~~i~~~~~~~~~i~~~~~~~~~~~~~~~k~~~   79 (343)
T 1fo8_A            1 LAVIPILVIACDRS-TVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQG   79 (343)
T ss_dssp             CCCCCEEEEESSCT-THHHHHHHHHHHCSCTTTSCEEEEECTTCHHHHHHHHTTGGGSEEEECSCCCCCCCCTTCGGGHH
T ss_pred             CCEEEEEEEECCCH-HHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHEECCCCCCCEECHHHHCCCC
T ss_conf             97042999976706-89999999996574678832999973895678999998777653101477677511301313440


Q ss_pred             HH---HHHH-HHHHHHH-CCCCEEEEEEECCCCCCCHHHHHHHHHHC-CCCCCEEEEECCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             99---9999-9999982-79985999730221330089999999841-55377544511366542221123467770589
Q gi|254781114|r   70 YI---SHIH-LWKRIAY-SPAIGAIILEDDADFSDEFSQLLPHLSKC-DINNILIKFDALRKKPKKDSYLCTLPGNFDIH  143 (263)
Q Consensus        70 ~l---SH~~-~w~~~~~-~~~~~~lIlEDD~~~~~~f~~~l~~~~~~-~~~~d~~~l~~~~~~~~~~~~~~~~~~~~~l~  143 (263)
                      +.   .|+. +..++-+ .+.+.++|||||.++.++|.++.+..... ..|-.+....+..-..  ............++
T Consensus        80 ~~~i~~hy~~aLn~~F~~~~~~~vIilEDDl~~spdF~~~~~~~l~~~~~d~~i~~Isa~n~ng--~~~~~~~~~~~~ly  157 (343)
T 1fo8_A           80 YYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNG--KEQMVDSSKPELLY  157 (343)
T ss_dssp             HHHHHHHHHHHHHHHHTTSCCSEEEEEETTEEECTTHHHHHHHHHHHHHHCTTEEEEESCCTTC--BGGGSCTTCTTCEE
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCEEECHHHHHHHHHHHHHHHCCCCEEEEECCCCCC--CCCCCCCCCCCEEE
T ss_conf             0779989999999987642787699982770351789999999999986189879995766778--65556678855499


Q ss_pred             EECCCCCCCEEEEECHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             940579851235666999999999625457804688799997598179996031
Q gi|254781114|r  144 QPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGA  197 (263)
Q Consensus       144 ~~~~~~~gt~aY~Is~~~AkkLl~~~~~~~~pvD~~l~~~~~~~l~~~~~~P~~  197 (263)
                      +...+  .+-|++++++.=+.+-.. .| ..-.|.||.....++-+ +.+.|-+
T Consensus       158 rs~~f--pgwGW~~~r~~W~e~~~k-w~-~~~wd~w~r~~~~rk~r-~cI~Pev  206 (343)
T 1fo8_A          158 RTDFF--PGLGWLLLAELWAELEPK-WP-KAFWDDWMRRPEQRKGR-ACVRPEI  206 (343)
T ss_dssp             EESSC--CCSSEEEEHHHHHHHGGG-CC-SSCHHHHHTSHHHHTTC-EEEEESS
T ss_pred             EECCC--CCHHHHHHHHHHHHHCCC-CC-CCCCHHHHHHHHHHCCC-EEEECCC
T ss_conf             81588--831201229899874424-66-65545888748873698-7886465



>2j0a_A Beta-1,3-N-acetylglucosaminyltransferase manic fringe; glycosyltransferase, developmental protein, transmembrane, golgi apparatus, notch signaling; 1.8A {Mus musculus} PDB: 2j0b_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 glycosyl transferase family protein [Candidatus Liberib
d1fo8a_343 N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus 97.83
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: N-acetylglucosaminyltransferase I
domain: N-acetylglucosaminyltransferase I
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=97.83  E-value=0.00067  Score=38.96  Aligned_cols=189  Identities=11%  Similarity=0.007  Sum_probs=101.9

Q ss_pred             CC-CCEEEEECCCCHHHHHHHHHHHHHC--CC-CEEEEECCCCCCCCHHHH--HHCCHHCC--------CC--CCCCCCH
Q ss_conf             98-8689980899889999999999877--99-789996637352896774--20200002--------46--7887887
Q gi|254781114|r    1 MP-IPVYVISLPFSHARREKFCHRAARI--HL-QFSFFDAIYGENNPICNR--IFSHQKRQ--------CQ--FKRLLSL   64 (263)
Q Consensus         1 m~-~kiyvInL~~~~~Rr~~~~~~~~~~--gi-~~e~~~Avdg~~~~~~~~--~~~~~~~~--------~~--~~~~l~~   64 (263)
                      |+ +||-|+.-.| ++ ..++.+.+-+.  +. .+..+=..||......+.  .+......        ..  ....-..
T Consensus         1 ~~viPVlv~a~NR-P~-l~r~LesLlk~~p~~~~~~I~Vs~DG~~~~~~~~v~~~~~~v~~I~~~~~~~~~~~~~~~k~~   78 (343)
T d1fo8a_           1 LAVIPILVIACDR-ST-VRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQ   78 (343)
T ss_dssp             CCCCCEEEEESSC-TT-HHHHHHHHHHHCSCTTTSCEEEEECTTCHHHHHHHHTTGGGSEEEECSCCCCCCCCTTCGGGH
T ss_pred             CCCCCEEEEECCH-HH-HHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCEECCHHHCCC
T ss_conf             9830489997577-88-999999998427556685389996499545799999988898873077545635421132033


Q ss_pred             HHHHHHHHHHHHHHHHHHC-CCCEEEEEEECCCCCCCHHHHHHHHHHC-CCCCCEEEEECCCCCCCCCCCCCCCCCCCEE
Q ss_conf             8999999999999999827-9985999730221330089999999841-5537754451136654222112346777058
Q gi|254781114|r   65 PEIGCYISHIHLWKRIAYS-PAIGAIILEDDADFSDEFSQLLPHLSKC-DINNILIKFDALRKKPKKDSYLCTLPGNFDI  142 (263)
Q Consensus        65 geigC~lSH~~~w~~~~~~-~~~~~lIlEDD~~~~~~f~~~l~~~~~~-~~~~d~~~l~~~~~~~~~~~~~~~~~~~~~l  142 (263)
                      |-.||+..=..+..++-+. +.+.++|||||..+.++|.++.+..... ..|-.+....+.+-. . ............+
T Consensus        79 ~n~giarhy~~AL~~~F~~~~~~~~IiLEDDl~~spdFf~y~~~~l~~~~~D~~i~~IS~wNdn-G-~~~~~~~~~~~~l  156 (343)
T d1fo8a_          79 GYYKIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDN-G-KEQMVDSSKPELL  156 (343)
T ss_dssp             HHHHHHHHHHHHHHHHHTTSCCSEEEEEETTEEECTTHHHHHHHHHHHHHHCTTEEEEESCCTT-C-BGGGSCTTCTTCE
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEHHHHHHHHHHHHHHHCCCCEEEEECCCCC-C-CCCCCCCCCCCEE
T ss_conf             1167888999999987411577649999257504077999999999997269977999666567-8-8665668987518


Q ss_pred             EEECCCCCCCEEEEECHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCEEEEECCCE
Q ss_conf             99405798512356669999999996254578046887999975981799960313
Q gi|254781114|r  143 HQPRILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAV  198 (263)
Q Consensus       143 ~~~~~~~~gt~aY~Is~~~AkkLl~~~~~~~~pvD~~l~~~~~~~l~~~~~~P~~v  198 (263)
                      ++... ..| -|++.+++.=+.|-.. .| ..-.|.||.......-+ ..+.|-+.
T Consensus       157 yrs~~-fpg-~GW~~~r~~W~el~~k-wp-~~~Wd~w~r~~~~rkgr-~cI~Pevs  207 (343)
T d1fo8a_         157 YRTDF-FPG-LGWLLLAELWAELEPK-WP-KAFWDDWMRRPEQRKGR-ACVRPEIS  207 (343)
T ss_dssp             EEESS-CCC-SSEEEEHHHHHHHGGG-CC-SSCHHHHHTSHHHHTTC-EEEEESSB
T ss_pred             EEECC-CCC-HHHHEEHHHHHHHHHC-CC-CCCCHHHHHHHHHCCCC-EEECCCCC
T ss_conf             86068-872-3322219889875230-78-88707766258763898-36405764



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target263 glycosyl transferase family protein [Candidatus Liberib
2icy_A_1-387387 Probable UTP-glucose-1-phosphate uridylyltransfera 91.31