254781115

254781115

poly(A) polymerase protein

GeneID in NCBI database:8210140Locus tag:CLIBASIA_05085
Protein GI in NCBI database:254781115Protein Accession:YP_003065528.1
Gene range:-(1116829, 1118079)Protein Length:416aa
Gene description:poly(A) polymerase protein
COG prediction:[J] tRNA nucleotidyltransferase/poly(A) polymerase
KEGG prediction:poly(A) polymerase protein
SEED prediction:tRNA nucleotidyltransferase (EC 2.7.7.21) (EC 2.7.7.25)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA nucleotidyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410------
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
cccccccHHcccHHHHHHHHHHHHcccEEEEEHHHHHHHHcccccccEEEEEcccHHHHHHHHHHcccccccccccccEEEEEEccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEccccHHHHHHccccEEcccHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcc
ccccccHcccccHHHHHHHHHHHHcccEEEEEccHHHHHHcccccccccEcccccHHHHHHHHHHHccccccccccccEEEEEEcccEEEEEEEEcccccccccccEEEEccHHHHHHHcccEEEHEcccccccEEcccccHHHHHHcEEEccccHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHcccccHHccHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcc
mvsivqhkwfhdsdLINILSLLnkgedkscivgGAVRDSLMNLSVQDIDIATTILPDRVMRIFSktrykviptsisygTIKIICRKkyfdittlrsdlitdgryakvvftrdwkadslrRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAhygeknidsdgLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNcnfnqktlsipeIKKLFYLYGDKVMIAKLKIFLALHynnlthqdTCFILQVLSDIihwkkplfpltgddvvkygippgkkvgNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
mvsivqhkwfhdsdLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQdidiattilpdrvmrifsktrykviptsisygtikiicrKKYFDITTlrsdlitdgryakvvftrdwkadslrRDFTINalyadqqgkvIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGeknidsdglvASIKAKKglkilsserIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
*******KWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIA***
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
****VQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ
MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
315122580421 poly(A) polymerase protein [Candidatus Liberibacter sol 1 1e-179
222086618418 poly(A) polymerase protein [Agrobacterium radiobacter K 1 8e-92
15966115419 hypothetical protein SMc02700 [Sinorhizobium meliloti 1 1 4e-90
110634525409 polynucleotide adenylyltransferase region [Mesorhizobiu 1 2e-88
227822872419 polyA polymerase family protein [Sinorhizobium fredii N 1 6e-88
116253238417 poly(A) polymerase [Rhizobium leguminosarum bv. viciae 1 5e-86
114707044415 probable poly(A) polymerase [Fulvimarina pelagi HTCC250 1 2e-85
241205753417 Polynucleotide adenylyltransferase region [Rhizobium le 1 1e-84
222149362420 poly(A) polymerase [Agrobacterium vitis S4] Length = 42 1 2e-84
209550368422 polynucleotide adenylyltransferase region [Rhizobium le 1 8e-84
>gi|315122580|ref|YP_004063069.1| poly(A) polymerase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 421 Back     alignment and organism information
 Score =  631 bits (1627), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 306/416 (73%), Positives = 364/416 (87%)

Query: 1   MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVM 60
           MVSI QHKWF D DLI+ILSLLN+G+DKSCIVGGAVR+SLMNLSVQDIDIATTILP+ +M
Sbjct: 1   MVSIAQHKWFCDPDLIHILSLLNQGKDKSCIVGGAVRNSLMNLSVQDIDIATTILPEVIM 60

Query: 61  RIFSKTRYKVIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRR 120
           +IFS+T YKVIPT ISYGT+ II  KK FDITTLRSDLITDGR+AKVVFT DWKADSLRR
Sbjct: 61  KIFSQTSYKVIPTGISYGTVTIIKNKKSFDITTLRSDLITDGRHAKVVFTHDWKADSLRR 120

Query: 121 DFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEK 180
           DFTINALYADQ G+VIDYVGGLNDL+NRTIKFIG+AHHRILEDYLRILRFFRFFAHYG+ 
Sbjct: 121 DFTINALYADQAGRVIDYVGGLNDLKNRTIKFIGNAHHRILEDYLRILRFFRFFAHYGQH 180

Query: 181 NIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQE 240
           +ID DGL ASI+AK GLKILSSERIW EI K+LEAKNPL+AI++M+NGGIFKEIFL+VQ+
Sbjct: 181 DIDPDGLAASIQAKAGLKILSSERIWLEIKKILEAKNPLHAIMYMHNGGIFKEIFLNVQD 240

Query: 241 ISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFN 300
            S+DQLSQVIE E+VF W+ID LLRFIVLI  ++K+SI+S+AKK SLPREI+YFL++   
Sbjct: 241 SSIDQLSQVIEGEKVFGWEIDPLLRFIVLIPLREKQSIISIAKKLSLPREIKYFLLACIG 300

Query: 301 CNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKK 360
            N  ++ +SI E+K+ FYLYG ++++ KLKIFL+L+Y NL  ++ C I Q++ DI HW K
Sbjct: 301 FNIEREKISIQEMKRFFYLYGREIVVIKLKIFLSLNYKNLDREEICHIRQIILDIEHWIK 360

Query: 361 PLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRKLIASSQ 416
           PLFPL GDDV+KYGIPPGKK+GNIL +C++EWI SSF+LS EDL HLL+K+I  S+
Sbjct: 361 PLFPLRGDDVLKYGIPPGKKIGNILSYCEKEWIKSSFKLSYEDLLHLLQKVIKFSR 416


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086618|ref|YP_002545152.1| poly(A) polymerase protein [Agrobacterium radiobacter K84] Length = 418 Back     alignment and organism information
>gi|15966115|ref|NP_386468.1| hypothetical protein SMc02700 [Sinorhizobium meliloti 1021] Length = 419 Back     alignment and organism information
>gi|110634525|ref|YP_674733.1| polynucleotide adenylyltransferase region [Mesorhizobium sp. BNC1] Length = 409 Back     alignment and organism information
>gi|227822872|ref|YP_002826844.1| polyA polymerase family protein [Sinorhizobium fredii NGR234] Length = 419 Back     alignment and organism information
>gi|116253238|ref|YP_769076.1| poly(A) polymerase [Rhizobium leguminosarum bv. viciae 3841] Length = 417 Back     alignment and organism information
>gi|114707044|ref|ZP_01439943.1| probable poly(A) polymerase [Fulvimarina pelagi HTCC2506] Length = 415 Back     alignment and organism information
>gi|241205753|ref|YP_002976849.1| Polynucleotide adenylyltransferase region [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 417 Back     alignment and organism information
>gi|222149362|ref|YP_002550319.1| poly(A) polymerase [Agrobacterium vitis S4] Length = 420 Back     alignment and organism information
>gi|209550368|ref|YP_002282285.1| polynucleotide adenylyltransferase region [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 422 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
PRK13299394 PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisi 8e-43
KOG2159416 KOG2159, KOG2159, KOG2159, tRNA nucleotidyltransferase/ 3e-37
COG0617412 COG0617, PcnB, tRNA nucleotidyltransferase/poly(A) poly 9e-58
cd05398139 cd05398, NT_ClassII-CCAase, Nucleotidyltransferase (NT) 8e-30
pfam01743126 pfam01743, PolyA_pol, Poly A polymerase head domain 8e-29
PRK11623472 PRK11623, pcnB, poly(A) polymerase I; Provisional 4e-17
TIGR02692466 TIGR02692, tRNA_CCA_actino, tRNA adenylyltransferase 7e-26
TIGR01942410 TIGR01942, pcnB, poly(A) polymerase 1e-25
PRK13297364 PRK13297, PRK13297, tRNA CCA-pyrophosphorylase; Provisi 2e-15
PRK13298417 PRK13298, PRK13298, tRNA CCA-pyrophosphorylase; Provisi 1e-13
PRK13296360 PRK13296, PRK13296, tRNA CCA-pyrophosphorylase; Provisi 8e-08
PRK10885409 PRK10885, cca, multifunctional tRNA nucleotidyl transfe 7e-18
PRK10885409 PRK10885, cca, multifunctional tRNA nucleotidyl transfe 0.002
>gnl|CDD|183958 PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|37370 KOG2159, KOG2159, KOG2159, tRNA nucleotidyltransferase/poly(A) polymerase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30962 COG0617, PcnB, tRNA nucleotidyltransferase/poly(A) polymerase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|143388 cd05398, NT_ClassII-CCAase, Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes Back     alignment and domain information
>gnl|CDD|110721 pfam01743, PolyA_pol, Poly A polymerase head domain Back     alignment and domain information
>gnl|CDD|183239 PRK11623, pcnB, poly(A) polymerase I; Provisional Back     alignment and domain information
>gnl|CDD|131739 TIGR02692, tRNA_CCA_actino, tRNA adenylyltransferase Back     alignment and domain information
>gnl|CDD|130997 TIGR01942, pcnB, poly(A) polymerase Back     alignment and domain information
>gnl|CDD|139469 PRK13297, PRK13297, tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|171962 PRK13298, PRK13298, tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|106256 PRK13296, PRK13296, tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|182810 PRK10885, cca, multifunctional tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|182810 PRK10885, cca, multifunctional tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 416 poly(A) polymerase protein [Candidatus Liberibacter asi
PRK13299394 tRNA CCA-pyrophosphorylase; Provisional 100.0
TIGR02692472 tRNA_CCA_actino tRNA adenylyltransferase; InterPro: IPR 100.0
COG0617412 PcnB tRNA nucleotidyltransferase/poly(A) polymerase [Tr 100.0
PRK10885410 cca multifunctional tRNA nucleotidyl transferase/2'3'-c 100.0
PRK13298413 tRNA CCA-pyrophosphorylase; Provisional 100.0
PRK13297364 tRNA CCA-pyrophosphorylase; Provisional 100.0
KOG2159416 consensus 100.0
PRK11623471 pcnB poly(A) polymerase I; Provisional 100.0
TIGR01942448 pcnB poly(A) polymerase; InterPro: IPR010206 This entry 100.0
PRK13296360 tRNA CCA-pyrophosphorylase; Provisional 100.0
cd05398139 NT_ClassII-CCAase Nucleotidyltransferase (NT) domain of 100.0
pfam01743126 PolyA_pol Poly A polymerase head domain. This family in 100.0
PHA01806205 hypothetical protein 97.04
cd07749156 NT_Pol-beta-like_1 Nucleotidyltransferase (NT) domain o 95.96
PRK05092 934 PII uridylyl-transferase; Provisional 99.32
PRK01759 862 glnD PII uridylyl-transferase; Provisional 99.13
PRK03381 781 PII uridylyl-transferase; Provisional 99.12
PRK00275 894 glnD PII uridylyl-transferase; Provisional 99.08
PRK04374 869 PII uridylyl-transferase; Provisional 98.99
PRK05007 881 PII uridylyl-transferase; Provisional 98.97
PRK00227 692 glnD PII uridylyl-transferase; Provisional 98.95
PRK03059 857 PII uridylyl-transferase; Provisional 98.94
COG2844 867 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttr 98.36
TIGR01693 903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 99.15
pfam10706174 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase. 95.56
pfam09970184 DUF2204 Conserved Archaeal protein (DUF2204). This doma 92.75
cd0539749 NT_Pol-beta-like Nucleotidyltransferase (NT) domain of 93.01
>PRK13299 tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR02692 tRNA_CCA_actino tRNA adenylyltransferase; InterPro: IPR014065 The enzyme tRNA adenylyltransferase, also called tRNA-nucleotidyltransferase and CCA-adding enzyme, can add or repair the required CCA triplet at the 3 -end of tRNA molecules Back     alignment and domain information
>COG0617 PcnB tRNA nucleotidyltransferase/poly(A) polymerase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10885 cca multifunctional tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase; Reviewed Back     alignment and domain information
>PRK13298 tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13297 tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>KOG2159 consensus Back     alignment and domain information
>PRK11623 pcnB poly(A) polymerase I; Provisional Back     alignment and domain information
>TIGR01942 pcnB poly(A) polymerase; InterPro: IPR010206 This entry describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein) Back     alignment and domain information
>PRK13296 tRNA CCA-pyrophosphorylase; Provisional Back     alignment and domain information
>cd05398 NT_ClassII-CCAase Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes Back     alignment and domain information
>pfam01743 PolyA_pol Poly A polymerase head domain Back     alignment and domain information
>PHA01806 hypothetical protein Back     alignment and domain information
>cd07749 NT_Pol-beta-like_1 Nucleotidyltransferase (NT) domain of an uncharacterized subgroup of the Pol beta-like NT superfamily Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01693 UTase_glnD protein-P-II uridylyltransferase; InterPro: IPR010043 This entry describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for signal-transduction protein PII, and acts as the sensory component of the nitrogen regulation (ntr) system Back     alignment and domain information
>pfam10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase Back     alignment and domain information
>pfam09970 DUF2204 Conserved Archaeal protein (DUF2204) Back     alignment and domain information
>cd05397 NT_Pol-beta-like Nucleotidyltransferase (NT) domain of DNA polymerase beta and similar proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
1ou5_A448 Crystal Structure Of Human Cca-Adding Enzyme Length 3e-52
1miy_A404 Crystal Structure Of Bacillus Stearothermophilus Cc 2e-46
1miv_A404 Crystal Structure Of Bacillus Stearothermophilus Cc 4e-45
3h38_A441 The Structure Of Cca-Adding Enzyme Apo Form Ii Leng 1e-32
3h37_A441 The Structure Of Cca-Adding Enzyme Apo Form I Lengt 9e-32
1vfg_A390 Crystal Structure Of Trna Nucleotidyltransferase Co 3e-28
3aql_A415 Structure Of Bacterial Protein (Apo Form Ii) Length 8e-31
3aqk_A414 Structure Of Bacterial Protein (Apo Form I) Length 9e-31
3aqm_A415 Structure Of Bacterial Protein (Form Ii) Length = 4 1e-30
>gi|30750040|pdb|1OU5|A Chain A, Crystal Structure Of Human Cca-Adding Enzyme Length = 448 Back     alignment and structure
 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 118/404 (29%), Positives = 199/404 (49%), Gaps = 13/404 (3%)

Query: 10  FHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYK 69
                L ++  L  K   +  I GGAVRD L  +  QDID ATT  P ++  +F     +
Sbjct: 54  LFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIR 113

Query: 70  VIPT-SISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALY 128
           +I      +GTI     ++ F+ITTLR D+ TDGR+A+V FT DW+ D+ RRD TIN+++
Sbjct: 114 MINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMF 173

Query: 129 ADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAH--YGEKNIDSDG 186
               G + DY  G  DL+N+ ++F+G A  RI EDYLRILR+FRF+        + D + 
Sbjct: 174 LGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPET 233

Query: 187 LVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQL 246
           L A  +  KGL  +S ERIW E+ K+L   + +N ++H+                SL++ 
Sbjct: 234 LEAIAENAKGLAGISGERIWVELKKILVGNH-VNHLIHLIYDLDVAPYIGLPANASLEEF 292

Query: 247 SQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQK 306
            +V +    F  K  +LL  +  +       +  +  +  + +E +   +        + 
Sbjct: 293 DKVSKNVDGFSPKPVTLLASLFKVQDD----VTKLDLRLKIAKEEKNLGLFIVKN--RKD 346

Query: 307 TLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLT 366
            +   +       Y D ++ ++           L +Q    +   L ++  W  P FP++
Sbjct: 347 LIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCL---LKEMQQWSIPPFPVS 403

Query: 367 GDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRK 410
           G D+ K GI  GK++G +L   +++W  S +Q+ +++L   ++K
Sbjct: 404 GHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKK 447


gi|27573947|pdb|1MIY|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Cca-Adding Enzyme In Complex With Ctp Length = 404 Back     alignment and structure
>gi|27573943|pdb|1MIV|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Cca-Adding Enzyme Length = 404 Back     alignment and structure
>gi|261278704|pdb|3H38|A Chain A, The Structure Of Cca-Adding Enzyme Apo Form Ii Length = 441 Back     alignment and structure
>gi|261278702|pdb|3H37|A Chain A, The Structure Of Cca-Adding Enzyme Apo Form I Length = 441 Back     alignment and structure
>gi|52696111|pdb|1VFG|A Chain A, Crystal Structure Of Trna Nucleotidyltransferase Complexed With A Primer Trna And An Incoming Atp Analog Length = 390 Back     alignment and structure
>gi|322812373|pdb|3AQL|A Chain A, Structure Of Bacterial Protein (Apo Form Ii) Length = 415 Back     alignment and structure
>gi|322812372|pdb|3AQK|A Chain A, Structure Of Bacterial Protein (Apo Form I) Length = 414 Back     alignment and structure
>gi|322812375|pdb|3AQM|A Chain A, Structure Of Bacterial Protein (Form Ii) Length = 415 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
1ou5_A448 TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; po 9e-64
1miw_A404 TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, tr 6e-51
3h38_A441 TRNA nucleotidyl transferase-related protein; transfera 8e-34
1vfg_A390 A-adding enzyme, poly A polymerase; transferase, RNA, r 2e-30
>1ou5_A TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens} SCOP: a.173.1.1 d.218.1.4 Length = 448 Back     alignment and structure
 Score =  239 bits (610), Expect = 9e-64
 Identities = 125/412 (30%), Positives = 201/412 (48%), Gaps = 16/412 (3%)

Query: 5   VQHKWFH---DSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMR 61
           +Q   F       L ++  L  K   +  I GGAVRD L  +  QDID ATT  P ++  
Sbjct: 46  LQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKE 105

Query: 62  IFSKTRYKVIPTS-ISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRR 120
           +F     ++I      +GTI     ++ F+ITTLR D+ TDGR+A+V FT DW+ D+ RR
Sbjct: 106 MFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERR 165

Query: 121 DFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRILEDYLRILRFFRFFAHYGEK 180
           D TIN+++    G + DY  G  DL+N+ ++F+G A  RI EDYLRILR+FRF+    +K
Sbjct: 166 DLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDK 225

Query: 181 --NIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDV 238
             + D + L A  +  KGL  +S ERIW E+ K+L   +  + I  +Y+  +   I L  
Sbjct: 226 PGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLP- 284

Query: 239 QEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISF 298
              SL++  +V +    F  K    L   +     D   +    K     + +  F++  
Sbjct: 285 ANASLEEFDKVSKNVDGFSPKPV-TLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKN 343

Query: 299 FNCNFNQKTLSIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHW 358
                     S P      ++   +   A  ++   L Y             +L ++  W
Sbjct: 344 RKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGE--------HCLLKEMQQW 395

Query: 359 KKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWINSSFQLSQEDLHHLLRK 410
             P FP++G D+ K GI  GK++G +L   +++W  S +Q+ +++L   ++K
Sbjct: 396 SIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKK 447


>1miw_A TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus} SCOP: a.173.1.1 d.218.1.4 PDB: 1miv_A* 1miy_A* Length = 404 Back     alignment and structure
>3h38_A TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A* Length = 441 Back     alignment and structure
>1vfg_A A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus} SCOP: a.173.1.1 d.218.1.4 Length = 390 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
1ou5_A448 TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; po 100.0
1miw_A404 TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, tr 100.0
3h38_A441 TRNA nucleotidyl transferase-related protein; transfera 100.0
1vfg_A390 A-adding enzyme, poly A polymerase; transferase, RNA, r 100.0
2fcl_A169 Hypothetical protein TM1012; putative nucleotidyltransf 95.01
>1ou5_A TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens} SCOP: a.173.1.1 d.218.1.4 Back     alignment and structure
Probab=100.00  E-value=0  Score=655.31  Aligned_cols=391  Identities=31%  Similarity=0.508  Sum_probs=325.7

Q ss_pred             CCCHHC---CCHHHHHHHHHHHHCCCEEEEEHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHCCCCEEC-CCCCCCEE
Q ss_conf             575221---99889999999997898599970699888778898608999808989999999876995621-34314469
Q gi|254781115|r    5 VQHKWF---HDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYKVIP-TSISYGTI   80 (416)
Q Consensus         5 ~~~~~~---~~~~~~~i~~~l~~~g~~~~~VGG~VRD~ll~~~~~DiD~~~~~~~~~~~~~~~~~~~~~~~-~~~~~gt~   80 (416)
                      .++|++   ..+++.+|++.+.++|+++|+|||||||+|||++++|+||||+++|++++++|++.+.+.+. .|.+|||+
T Consensus        46 ~~~~~~~~~~~~~~~~~~~~~~~~g~e~y~VGG~VRD~llg~~~~DiDi~~~~~p~~~~~~~~~~~~~~~~~~g~~~gt~  125 (448)
T 1ou5_A           46 LQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTI  125 (448)
T ss_dssp             CCCHHHHHHSCTTHHHHHHHHHHTTCCEEEESTTTHHHHHTSCCSSCEEEESSCHHHHHHHHTTTTCCBCCCCCTTCCCE
T ss_pred             CCCHHHHHHCCHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             37813454368899999999998799899973699998779889998999948899999999974981047678413189


Q ss_pred             EEEECCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCHHHHHCCCHHHHHHHHHHHCCCCCCHH
Q ss_conf             99989988864213446676887432233201332104478003002000321013200006888787776427643100
Q gi|254781115|r   81 KIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAHHRI  160 (416)
Q Consensus        81 ~~~~~~~~~di~~~R~e~~~~~~~~~~~~~~~~~eDl~RRDFTINAla~~~~~~l~Dp~gG~~DL~~~~ir~v~~~~~rf  160 (416)
                      ++..++..+||||+|+|.|++||+++++++++|++||.|||||||||||+++|+|+|||||++||++|+||+||+|++||
T Consensus       126 ~~~~~~~~~ei~~~r~e~~~~~~~~~~~~~~~~~~Dl~RRDFTINAma~~~~g~i~D~~~G~~DL~~~~ir~v~~~~~~f  205 (448)
T 1ou5_A          126 TARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRI  205 (448)
T ss_dssp             EECTTTTCEEEEECCS------------SSCCSSCCGGGSSBGGGSCEECSSCBEECSSSHHHHTTTTCCCBSSTTTTTS
T ss_pred             EEEECCEEEEEEEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEECCCCEECCCCCHHHHHCCCEEECCCHHHHH
T ss_conf             99989979999999877325898886244777243442256412237881699883898987787478512437827865


Q ss_pred             HCCCCCEEEEEEEEECCCCC--CCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             10421003320122013643--3111100012333321022205776887886421101899999875300233468870
Q gi|254781115|r  161 LEDYLRILRFFRFFAHYGEK--NIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNGGIFKEIFLDV  238 (416)
Q Consensus       161 ~EDpLRiLRa~RFasrlg~f--~id~~t~~ai~~~~~~L~~iS~ERI~~El~KiL~~~~~~~~l~~L~~~gll~~ifpel  238 (416)
                      .|||||||||+||+|+||+.  .++++|+.+|+++++.|..+|+||||+||.|||.+++|..++..|.++|+++.+||..
T Consensus       206 ~eDplRiLRa~RF~a~l~f~~~~~~~~t~~ai~~~~~~L~~lS~ERI~~El~KiL~~~~~~~~l~~L~e~gll~~i~~~~  285 (448)
T 1ou5_A          206 QEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPA  285 (448)
T ss_dssp             SSCTTHHHHHHHHHHHSCSSSSCCCHHHHHHHHHSCTTGGGSCSHHHHHHHHHHHTSTTHHHHHHHHHHTTCGGGGTCCC
T ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHCHHH
T ss_conf             43620899999998740010110208899999987643134788899999999975998899999999878777648166


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCC--CCHHHHHHH
Q ss_conf             105857898778677631788016766652047768578998875303425677778888754114333--672466789
Q gi|254781115|r  239 QEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKT--LSIPEIKKL  316 (416)
Q Consensus       239 ~~~~~~~l~~~~~~~~~~~~~~~~~lrla~Ll~~~~~~~~~~~~~rlkl~~~~~~~l~~~~~~~~~~~~--~~~~~~~~~  316 (416)
                      .. +...+.+.....  .....++++++++|+++.+  .+..++++|++|+++++.+..+...+.....  .....++.+
T Consensus       286 ~~-~l~~~~~~~~~l--~~~~~~~~~~LaaLl~~~~--~~~~~~~rLklsk~~~~~i~~l~~~~~~l~~~~~~~~~~~~~  360 (448)
T 1ou5_A          286 NA-SLEEFDKVSKNV--DGFSPKPVTLLASLFKVQD--DVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPY  360 (448)
T ss_dssp             CS-CCHHHHHHHHHH--TTSCCCHHHHHGGGCCSTT--TTHHHHHHHCCCTTHHHHHHHHTTTTTTTSCCCSSSSTTHHH
T ss_pred             HH-HHHHHHHHHHHH--HHCCCHHHHHHHHHHHHHH--HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             75-799999999997--5158126678999975432--467899872167999999999999999998721304479999


Q ss_pred             H---HHCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9---8708024551698999864077760138999999987751288888988789996589877799999999999996
Q gi|254781115|r  317 F---YLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVKYGIPPGKKVGNILVHCKQEWI  393 (416)
Q Consensus       317 ~---~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~p~~pI~G~dL~~~Gi~pGp~iG~iL~~l~~~~i  393 (416)
                      .   ........  .........        .......++.+..|..|.+||+|+|||++|++|||++|++|++++++|+
T Consensus       361 ~~~~~~~~~~~~--~~~~~~l~~--------~~~~~~ll~~~~~~~~p~lpI~G~DLm~lGi~pGP~iG~iLk~L~~~wi  430 (448)
T 1ou5_A          361 QDFIIDSREPDA--TTRVCELLK--------YQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWK  430 (448)
T ss_dssp             HHHHHHCCSTTH--HHHHHHHHH--------HHTCHHHHHHHTTCCC---------------------------------
T ss_pred             HHHHHHCCCCHH--HHHHHHHHH--------CCCHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999986035168--999999864--------5568999999971789999909999987879814899999999999999


Q ss_pred             CCCCCCCHHHHHHHHHH
Q ss_conf             38888898999999999
Q gi|254781115|r  394 NSSFQLSQEDLHHLLRK  410 (416)
Q Consensus       394 ~~~~~n~~e~l~~~lk~  410 (416)
                      ++++++++|++++++|+
T Consensus       431 e~~~~~skeelL~~iKk  447 (448)
T 1ou5_A          431 KSGYQMEKDELLSYIKK  447 (448)
T ss_dssp             -----------------
T ss_pred             HCCCCCCHHHHHHHHCC
T ss_conf             78799999999998454



>1miw_A TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus} SCOP: a.173.1.1 d.218.1.4 PDB: 1miv_A* 1miy_A* Back     alignment and structure
>3h38_A TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A* Back     alignment and structure
>1vfg_A A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus} SCOP: a.173.1.1 d.218.1.4 Back     alignment and structure
>2fcl_A Hypothetical protein TM1012; putative nucleotidyltransferase, structural genomics, joint for structural genomics, JCSG; HET: MLY; 1.20A {Thermotoga maritima} SCOP: d.218.1.11 PDB: 2ewr_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 416 poly(A) polymerase protein [Candidatus Liberibacter asi
d1miwa1265 a.173.1.1 (A:140-404) tRNA CCA-adding enzyme, C-termina 8e-26
d1ou5a2152 d.218.1.4 (A:-1-150) tRNA CCA-adding enzyme, head domai 6e-24
d1miwa2139 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain 2e-23
d1vfga2136 d.218.1.4 (A:1-136) Poly A polymerase PcnB {Aquifex aeo 1e-18
d1ou5a1204 a.173.1.1 (A:151-354) tRNA CCA-adding enzyme, C-termina 2e-20
d1vfga1215 a.173.1.1 (A:137-351) Poly A polymerase PcnB {Aquifex a 6e-11
>d1miwa1 a.173.1.1 (A:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]} Length = 265 Back     information, alignment and structure

class: All alpha proteins
fold: Poly A polymerase C-terminal region-like
superfamily: Poly A polymerase C-terminal region-like
family: Poly A polymerase C-terminal region-like
domain: tRNA CCA-adding enzyme, C-terminal domains
species: Bacillus stearothermophilus [TaxId: 1422]
 Score =  111 bits (279), Expect = 8e-26
 Identities = 44/262 (16%), Positives = 94/262 (35%), Gaps = 8/262 (3%)

Query: 150 IKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEI 209
           I+ +G+A  R  ED LR++R  RF +  G   +  D   A ++    L  +S ER+  E+
Sbjct: 2   IRTVGEAEKRFREDALRMMRAVRFVSELGFA-LAPDTEQAIVQNAPLLAHISVERMTMEM 60

Query: 210 NKLLEAKNPLNAIVHMYNGGIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVL 269
            KLL       A+  +   G+   +      ++  +    + A   + W      R+ +L
Sbjct: 61  EKLLGGPFAARALPLLAETGLNAYLP----GLAGKEKQLRLAAAYRWPWLAAREERWALL 116

Query: 270 ISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTLSIPEIKKLFYLYGDKVMIAKL 329
                 +      + + LP ++     +      +          +  +  G +  ++  
Sbjct: 117 CHALGVQESRPFLRAWKLPNKVVDEAGAILTALADIPR-PEAWTNEQLFSAGLERALSVE 175

Query: 330 KIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVK-YGIPPGKKVGNILVHC 388
            +  A             + +  + +    K    + G DV++  G P G  V   L   
Sbjct: 176 TVRAAFTGAPPG-PWHEKLRRRFASLPIKTKGELAVNGKDVIEWVGKPAGPWVKEALDAI 234

Query: 389 KQEWINSSFQLSQEDLHHLLRK 410
            +  +N   +  +E ++  L +
Sbjct: 235 WRAVVNGEVENEKERIYAWLME 256


>d1ou5a2 d.218.1.4 (A:-1-150) tRNA CCA-adding enzyme, head domain {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1miwa2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 139 Back     information, alignment and structure
>d1vfga2 d.218.1.4 (A:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} Length = 136 Back     information, alignment and structure
>d1ou5a1 a.173.1.1 (A:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 204 Back     information, alignment and structure
>d1vfga1 a.173.1.1 (A:137-351) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} Length = 215 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
d1miwa1265 tRNA CCA-adding enzyme, C-terminal domains {Bacillus st 100.0
d1ou5a2152 tRNA CCA-adding enzyme, head domain {Human (Homo sapien 100.0
d1vfga2136 Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363] 100.0
d1miwa2139 tRNA CCA-adding enzyme, head domain {Bacillus stearothe 100.0
d1ou5a1204 tRNA CCA-adding enzyme, C-terminal domains {Human (Homo 99.96
d1vfga1215 Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363] 99.94
d2fcla1157 Hypothetical protein TM1012 {Thermotoga maritima [TaxId 96.02
d1r89a2142 tRNA nucleotidyltransferase, N-terminal domain {Archaeo 94.88
>d1miwa1 a.173.1.1 (A:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: All alpha proteins
fold: Poly A polymerase C-terminal region-like
superfamily: Poly A polymerase C-terminal region-like
family: Poly A polymerase C-terminal region-like
domain: tRNA CCA-adding enzyme, C-terminal domains
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00  E-value=2.8e-45  Score=319.99  Aligned_cols=259  Identities=17%  Similarity=0.177  Sum_probs=200.0

Q ss_pred             HHHHCCCCCCHHHCCCCCEEEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             77642764310010421003320122013643311110001233332102220577688788642110189999987530
Q gi|254781115|r  149 TIKFIGDAHHRILEDYLRILRFFRFFAHYGEKNIDSDGLVASIKAKKGLKILSSERIWSEINKLLEAKNPLNAIVHMYNG  228 (416)
Q Consensus       149 ~ir~v~~~~~rf~EDpLRiLRa~RFasrlg~f~id~~t~~ai~~~~~~L~~iS~ERI~~El~KiL~~~~~~~~l~~L~~~  228 (416)
                      +||+||||.+||.|||||||||+||++||| |+||++|..+|+++++.|..||+||||+|+.||+.+++|..++..|.++
T Consensus         1 iiR~vg~p~~rf~EDpLRiLRa~RFa~rl~-f~i~~~t~~ai~~~~~~l~~vS~ERI~~El~kil~~~~~~~~l~~l~~~   79 (265)
T d1miwa1           1 IIRTVGEAEKRFREDALRMMRAVRFVSELG-FALAPDTEQAIVQNAPLLAHISVERMTMEMEKLLGGPFAARALPLLAET   79 (265)
T ss_dssp             EECBSSCHHHHHHHCTHHHHHHHHHHHHHC-CEECHHHHHHHHHHGGGGGGSCHHHHHHHHHHHHTSSSHHHHHHHHHHS
T ss_pred             CEEECCCHHHHCCCCHHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             964379889850523789999999999948-7836999999999899887669999999999999642468999999988


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             02334688701058578987786776317880167666520477685789988753034256777788887541143336
Q gi|254781115|r  229 GIFKEIFLDVQEISLDQLSQVIEAEQVFEWKIDSLLRFIVLISWQDKKSILSMAKKFSLPREIRYFLISFFNCNFNQKTL  308 (416)
Q Consensus       229 gll~~ifpel~~~~~~~l~~~~~~~~~~~~~~~~~lrla~Ll~~~~~~~~~~~~~rlkl~~~~~~~l~~~~~~~~~~~~~  308 (416)
                      |+++ ++|++....  ...+.... ...........+|++++|+.++.....++.++++|++..+.+..+...+......
T Consensus        80 gl~~-~lp~l~~~~--~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~lk~s~~~~~~~~~~~~~~~~~~~~  155 (265)
T d1miwa1          80 GLNA-YLPGLAGKE--KQLRLAAA-YRWPWLAAREERWALLCHALGVQESRPFLRAWKLPNKVVDEAGAILTALADIPRP  155 (265)
T ss_dssp             TTTT-SSTTCSSCH--HHHHHGGG-SCGGGCCSHHHHHHHHHHHHTCSCHHHHHHHTTCCHHHHHHHHHHHHHHHHCCSG
T ss_pred             CHHH-HCCCCCCHH--HHHHHHHH-HHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             8298-671644203--58888888-6400003167789999876117778887773278889999999999878877766


Q ss_pred             CHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHH-CCCCCCHHHHHHHHH
Q ss_conf             7246678998708024551698999864077760138999999987751288888988789996-589877799999999
Q gi|254781115|r  309 SIPEIKKLFYLYGDKVMIAKLKIFLALHYNNLTHQDTCFILQVLSDIIHWKKPLFPLTGDDVVK-YGIPPGKKVGNILVH  387 (416)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~p~~pI~G~dL~~-~Gi~pGp~iG~iL~~  387 (416)
                      . ....+.+|..+.........+........ .......+...+........+.++|+|+|||+ +|++|||++|+++++
T Consensus       156 ~-~~~~~~~~~~~~~~~~~~~~l~~~~~~~~-~~~~~~~l~~~~~~~~~~~~~~l~i~G~dL~~~~g~~pGp~iG~il~~  233 (265)
T d1miwa1         156 E-AWTNEQLFSAGLERALSVETVRAAFTGAP-PGPWHEKLRRRFASLPIKTKGELAVNGKDVIEWVGKPAGPWVKEALDA  233 (265)
T ss_dssp             G-GCCHHHHHHHHHHHHHHHHHHHHHHHCCC-SHHHHHHHHHHHTTCSCSSGGGCSSCHHHHHHHHTCCSSHHHHHHHHH
T ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHHHHCHHHHCCCCCCCHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             7-78899887768888888999999986598-056799999999856365424468898999988099977799999999


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             999996388888989999999999874
Q gi|254781115|r  388 CKQEWINSSFQLSQEDLHHLLRKLIAS  414 (416)
Q Consensus       388 l~~~~i~~~~~n~~e~l~~~lk~l~~~  414 (416)
                      ++++|++|++.|++|++.+++++...+
T Consensus       234 l~~~~l~~~~~n~ke~l~~~l~~~~k~  260 (265)
T d1miwa1         234 IWRAVVNGEVENEKERIYAWLMERNRT  260 (265)
T ss_dssp             HHHHHHTTSSCSCHHHHHHHHHHHHTH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             999997599999899999999986375



>d1vfga2 d.218.1.4 (A:1-136) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1miwa2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ou5a1 a.173.1.1 (A:151-354) tRNA CCA-adding enzyme, C-terminal domains {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1vfga1 a.173.1.1 (A:137-351) Poly A polymerase PcnB {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fcla1 d.218.1.11 (A:1-157) Hypothetical protein TM1012 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r89a2 d.218.1.7 (A:1-142) tRNA nucleotidyltransferase, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 416 poly(A) polymerase protein [Candidatus Liberibacte
1ou5_A_1-202202 (A:1-202) TRNA CCA-adding enzyme, tRNA-nucleotidyl 6e-32
3h38_A_1-160160 (A:1-160) TRNA nucleotidyl transferase-related pro 4e-27
1miw_A_1-138138 (A:1-138) TRNA CCA-adding enzyme; tRNA nucleotidyl 8e-27
1vfg_A_1-126126 (A:1-126) A-adding enzyme, poly A polymerase; tran 2e-26
1vfg_A_127-22296 (A:127-222) A-adding enzyme, poly A polymerase; tr 2e-18
3h38_A_161-24787 (A:161-247) TRNA nucleotidyl transferase-related p 1e-15
1miw_A_139-242104 (A:139-242) TRNA CCA-adding enzyme; tRNA nucleotid 4e-15
1ou5_A_203-28280 (A:203-282) TRNA CCA-adding enzyme, tRNA-nucleotid 2e-14
1ou5_A_283-448166 (A:283-448) TRNA CCA-adding enzyme, tRNA-nucleotid 2e-12
>1ou5_A (A:1-202) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens}Length = 202 Back     alignment and structure
 Score =  132 bits (334), Expect = 6e-32
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 1/157 (0%)

Query: 1   MVSIVQHKWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVM 60
            +   + +      L ++  L  K   +  I GGAVRD L  +  QDID ATT  P ++ 
Sbjct: 45  KLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMK 104

Query: 61  RIFSKTRYK-VIPTSISYGTIKIICRKKYFDITTLRSDLITDGRYAKVVFTRDWKADSLR 119
            +F     + +      +GTI     ++ F+ITTLR D+ TDGR+A+V FT DW+ D+ R
Sbjct: 105 EMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAER 164

Query: 120 RDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDA 156
           RD TIN+++    G + DY  G  DL+N+ ++F+G A
Sbjct: 165 RDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHA 201


>3h38_A (A:1-160) TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A*Length = 160 Back     alignment and structure
>1miw_A (A:1-138) TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus}Length = 138 Back     alignment and structure
>1vfg_A (A:1-126) A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus}Length = 126 Back     alignment and structure
>1vfg_A (A:127-222) A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus}Length = 96 Back     alignment and structure
>3h38_A (A:161-247) TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A*Length = 87 Back     alignment and structure
>1miw_A (A:139-242) TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus}Length = 104 Back     alignment and structure
>1ou5_A (A:203-282) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens}Length = 80 Back     alignment and structure
>1ou5_A (A:283-448) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens}Length = 166 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target416 poly(A) polymerase protein [Candidatus Liberibacter asi
1ou5_A_1-202202 TRNA CCA-adding enzyme, tRNA-nucleotidyltransferas 100.0
3h38_A_1-160160 TRNA nucleotidyl transferase-related protein; tran 100.0
1miw_A_1-138138 TRNA CCA-adding enzyme; tRNA nucleotidyltransferas 100.0
1vfg_A_1-126126 A-adding enzyme, poly A polymerase; transferase, R 100.0
1vfg_A_127-22296 A-adding enzyme, poly A polymerase; transferase, R 99.87
1miw_A_139-242104 TRNA CCA-adding enzyme; tRNA nucleotidyltransferas 99.81
3h38_A_161-24787 TRNA nucleotidyl transferase-related protein; tran 99.76
1ou5_A_203-28280 TRNA CCA-adding enzyme, tRNA-nucleotidyltransferas 99.72
1ou5_A_283-448166 TRNA CCA-adding enzyme, tRNA-nucleotidyltransferas 99.72
1miw_A_345-40460 TRNA CCA-adding enzyme; tRNA nucleotidyltransferas 98.9
2fcl_A_1-141141 Hypothetical protein TM1012; structural genomics, 94.66
>1ou5_A (A:1-202) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=324.44  Aligned_cols=150  Identities=38%  Similarity=0.627  Sum_probs=141.0

Q ss_pred             HHCCCHHHHHHHHHHHHCCCEEEEEHHHHHHHHCCCCCCEEEEEEECCHHHHHHHHHHCCCC-EECCCCCCCEEEEEECC
Q ss_conf             22199889999999997898599970699888778898608999808989999999876995-62134314469999899
Q gi|254781115|r    8 KWFHDSDLINILSLLNKGEDKSCIVGGAVRDSLMNLSVQDIDIATTILPDRVMRIFSKTRYK-VIPTSISYGTIKIICRK   86 (416)
Q Consensus         8 ~~~~~~~~~~i~~~l~~~g~~~~~VGG~VRD~ll~~~~~DiD~~~~~~~~~~~~~~~~~~~~-~~~~~~~~gt~~~~~~~   86 (416)
                      .+.....+..|.+.+.+.|+++|+|||||||+|||++++||||+|+++|+++++.|.+.+.. ++..++.|||+++..++
T Consensus        52 ~~~~~~~l~~i~~~~~~~g~~~ylVGG~VRD~LLg~~~~DiDi~~~~~~~~~~~~l~~~~~~~~~~~~~~f~t~~~~~~~  131 (202)
T 1ou5_A           52 QSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHE  131 (202)
T ss_dssp             HHHSCTTHHHHHHHHHHTTCCEEEESTTTHHHHHTSCCSSCEEEESSCHHHHHHHHTTTTCCBCCCCCTTCCCEEECTTT
T ss_pred             HHHCCHHHHHHHHHHHHCCCEEEEECHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECC
T ss_conf             53368899999999998799899972699998779889998999948899999999974981147678412289999899


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCEEECCCCHHHHHCCCHHHHHHHHHHHCCCCC
Q ss_conf             88864213446676887432233201332104478003002000321013200006888787776427643
Q gi|254781115|r   87 KYFDITTLRSDLITDGRYAKVVFTRDWKADSLRRDFTINALYADQQGKVIDYVGGLNDLRNRTIKFIGDAH  157 (416)
Q Consensus        87 ~~~di~~~R~e~~~~~~~~~~~~~~~~~eDl~RRDFTINAla~~~~~~l~Dp~gG~~DL~~~~ir~v~~~~  157 (416)
                      ..+||+++|+|+|+++++.|+++.++|++||+|||||||||||+++|+|+|||||++||++|+||+|++|+
T Consensus       132 ~~idi~~~R~e~y~~~~~~p~v~~~~l~eDl~RRDFTINAla~~l~~~liD~~gG~~DL~~~~iR~v~~p~  202 (202)
T 1ou5_A          132 ENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAK  202 (202)
T ss_dssp             TCEEEEECCS------------SSCCSSCCGGGSSBGGGSCEECSSCBEECSSSHHHHTTTTCCCBSSTTT
T ss_pred             EEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCCEEEECCCCCEECCCCCHHHHHCCCEEECCCCH
T ss_conf             78999999876215898886235676455577558862115762599570788877678468245547947



>3h38_A (A:1-160) TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A* Back     alignment and structure
>1miw_A (A:1-138) TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus} Back     alignment and structure
>1vfg_A (A:1-126) A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus} Back     alignment and structure
>1vfg_A (A:127-222) A-adding enzyme, poly A polymerase; transferase, RNA, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: APC; 2.80A {Aquifex aeolicus} Back     alignment and structure
>1miw_A (A:139-242) TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus} Back     alignment and structure
>3h38_A (A:161-247) TRNA nucleotidyl transferase-related protein; transferase/RNA, nucleotide-binding, RNA-binding; 2.37A {Thermotoga maritima} PDB: 3h37_A 3h39_A* 3h3a_A* Back     alignment and structure
>1ou5_A (A:203-282) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens} Back     alignment and structure
>1ou5_A (A:283-448) TRNA CCA-adding enzyme, tRNA-nucleotidyltransferase; polymerase, translation; 3.40A {Homo sapiens} Back     alignment and structure
>1miw_A (A:345-404) TRNA CCA-adding enzyme; tRNA nucleotidyltransferase, translation, transferase; HET: ATP; 3.00A {Geobacillus stearothermophilus} Back     alignment and structure
>2fcl_A (A:1-141) Hypothetical protein TM1012; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MLY; 1.20A {Thermotoga maritima} Back     alignment and structure