255764512

255764512

preprotein tranlocase protein

GeneID in NCBI database:8210141Locus tag:CLIBASIA_05090
Protein GI in NCBI database:255764512Protein Accession:YP_003065529.2
Gene range:-(1118386, 1118712)Protein Length:108aa
Gene description:preprotein tranlocase protein
COG prediction:[U] Preprotein translocase subunit YajC
KEGG prediction:yajC; preprotein tranlocase protein; K03210 preprotein translocase subunit YajC
SEED prediction:Preprotein translocase subunit YajC (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV
ccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEEEccccEEEEEEccccEEEEEHHHHHHHHcccccc
cccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEEEEEEEcccEEEEEEcccEEEEEEEHHHEEEccccccc
mfttvyaqsdapaitsatsplEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEvqsksepv
mfttvyaqsdapaitsatspLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRnlrrgdsivtaagivgkvVRVIDDLELeveiaenvrvrVVRSfvsevqsksepv
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFllirpqrqqlqrrAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENvrvrvvrsfvsevqsKSEPV
MFTTVYA***************MAGLFFVLAVVWYFLLIRPQR*************RRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK****
********SDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFV**********
**T**YAQS*A******TSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSK****
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV
MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGDSIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target108 preprotein tranlocase protein [Candidatus Liberibacter
315122581112 preprotein tranlocase protein [Candidatus Liberibacter 1 3e-42
222085793116 preprotein tranlocase protein [Agrobacterium radiobacte 1 8e-29
86357459115 preprotein tranlocase protein [Rhizobium etli CFN 42] L 1 4e-27
218512650115 putative Sec translocase associated protein [Rhizobium 1 3e-26
15965291110 YAJC protein [Sinorhizobium meliloti 1021] Length = 110 1 5e-26
150396392110 preprotein translocase subunit YajC [Sinorhizobium medi 1 1e-25
209549096115 preprotein translocase, YajC subunit [Rhizobium legumin 1 1e-25
6970056110 putative membrane protein [Sinorhizobium meliloti] Leng 1 2e-25
116251814115 Sec translocase associated protein [Rhizobium leguminos 1 3e-25
325292959115 preprotein tranlocase protein [Agrobacterium sp. H13-3] 1 3e-25
>gi|315122581|ref|YP_004063070.1| preprotein tranlocase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 112 Back     alignment and organism information
 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/108 (75%), Positives = 95/108 (87%)

Query: 1   MFTTVYAQSDAPAITSATSPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRNLRRGD 60
           +FT  YAQSDAP+I S TSPLEMA LFFVLAVVWYFLLIRPQRQQ ++R+EML NLRRGD
Sbjct: 2   LFTKAYAQSDAPSINSVTSPLEMAFLFFVLAVVWYFLLIRPQRQQFKKRSEMLHNLRRGD 61

Query: 61  SIVTAAGIVGKVVRVIDDLELEVEIAENVRVRVVRSFVSEVQSKSEPV 108
           SIVTAAGI+GK+ +VIDD E+EVEI+E VRV V+RS++SEV SK EPV
Sbjct: 62  SIVTAAGIIGKITKVIDDSEVEVEISEGVRVHVLRSYISEVLSKPEPV 109


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085793|ref|YP_002544323.1| preprotein tranlocase protein [Agrobacterium radiobacter K84] Length = 116 Back     alignment and organism information
>gi|86357459|ref|YP_469351.1| preprotein tranlocase protein [Rhizobium etli CFN 42] Length = 115 Back     alignment and organism information
>gi|218512650|ref|ZP_03509490.1| putative Sec translocase associated protein [Rhizobium etli 8C-3] Length = 115 Back     alignment and organism information
>gi|15965291|ref|NP_385644.1| YAJC protein [Sinorhizobium meliloti 1021] Length = 110 Back     alignment and organism information
>gi|150396392|ref|YP_001326859.1| preprotein translocase subunit YajC [Sinorhizobium medicae WSM419] Length = 110 Back     alignment and organism information
>gi|209549096|ref|YP_002281013.1| preprotein translocase, YajC subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 115 Back     alignment and organism information
>gi|6970056|gb|AAF34181.1|AF217543_2 putative membrane protein [Sinorhizobium meliloti] Length = 110 Back     alignment and organism information
>gi|116251814|ref|YP_767652.1| Sec translocase associated protein [Rhizobium leguminosarum bv. viciae 3841] Length = 115 Back     alignment and organism information
>gi|325292959|ref|YP_004278823.1| preprotein tranlocase protein [Agrobacterium sp. H13-3] Length = 115 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target108 preprotein tranlocase protein [Candidatus Liberibacter
PRK05585106 PRK05585, yajC, preprotein translocase subunit YajC; Va 9e-19
COG186297 COG1862, YajC, Preprotein translocase subunit YajC [Int 5e-18
TIGR0073984 TIGR00739, yajC, preprotein translocase, YajC subunit 1e-12
PRK06531113 PRK06531, yajC, preprotein translocase subunit YajC; Va 0.002
pfam0269983 pfam02699, YajC, Preprotein translocase subunit 2e-20
>gnl|CDD|180149 PRK05585, yajC, preprotein translocase subunit YajC; Validated Back     alignment and domain information
>gnl|CDD|32047 COG1862, YajC, Preprotein translocase subunit YajC [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162016 TIGR00739, yajC, preprotein translocase, YajC subunit Back     alignment and domain information
>gnl|CDD|180609 PRK06531, yajC, preprotein translocase subunit YajC; Validated Back     alignment and domain information
>gnl|CDD|145709 pfam02699, YajC, Preprotein translocase subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 108 preprotein tranlocase protein [Candidatus Liberibacter
PRK05585107 yajC preprotein translocase subunit YajC; Validated 100.0
PRK05886108 yajC preprotein translocase subunit YajC; Validated 99.96
COG186297 YajC Preprotein translocase subunit YajC [Intracellular 99.96
TIGR0073986 yajC preprotein translocase, YajC subunit; InterPro: IP 99.95
pfam0269983 YajC Preprotein translocase subunit. See. 99.95
PRK06531120 yajC preprotein translocase subunit YajC; Validated 99.94
PRK00409780 recombination and DNA strand exchange inhibitor protein 92.07
>PRK05585 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information
>PRK05886 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00739 yajC preprotein translocase, YajC subunit; InterPro: IPR003849 This entry describes proteins of unknown function Back     alignment and domain information
>pfam02699 YajC Preprotein translocase subunit Back     alignment and domain information
>PRK06531 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target108 preprotein tranlocase protein [Candidatus Liberibacter
2rdd_B37 X-Ray Crystal Structure Of Acrb In Complex With A N 8e-04
>gi|162330121|pdb|2RDD|B Chain B, X-Ray Crystal Structure Of Acrb In Complex With A Novel Transmembrane Helix Length = 37 Back     alignment and structure
 Score = 47.0 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 8/37 (21%), Positives = 25/37 (67%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN 55
          SP+ +  +  V  +++YF+++RPQ+++ +   +++ +
Sbjct: 1  SPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDS 37


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target108 preprotein tranlocase protein [Candidatus Liberibacter
2rdd_B37 UPF0092 membrane protein YAJC; drug resistance, multidr 7e-05
>2rdd_B UPF0092 membrane protein YAJC; drug resistance, multidrug efflux, transporter, antiporter, novel transmembrane helix, ACRB, inner membrane; HET: AIC; 3.50A {Escherichia coli} Length = 37 Back     alignment and structure
 Score = 41.1 bits (97), Expect = 7e-05
 Identities = 8/37 (21%), Positives = 25/37 (67%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN 55
          SP+ +  +  V  +++YF+++RPQ+++ +   +++ +
Sbjct: 1  SPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDS 37


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target108 preprotein tranlocase protein [Candidatus Liberibacter
2rdd_B37 UPF0092 membrane protein YAJC; drug resistance, multidr 99.17
>2rdd_B UPF0092 membrane protein YAJC; drug resistance, multidrug efflux, transporter, antiporter, novel transmembrane helix, ACRB, inner membrane; HET: AIC; 3.50A {Escherichia coli} Back     alignment and structure
Probab=99.17  E-value=5.7e-12  Score=92.68  Aligned_cols=37  Identities=22%  Similarity=0.726  Sum_probs=34.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             6358999999999999999606128999999999972
Q gi|255764512|r   19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN   55 (108)
Q Consensus        19 ~~~~~l~~~~~~~~i~yF~~iRPq~Kr~k~~~~m~~~   55 (108)
                      |++++++++++++++|||++||||+||+|||++|++|
T Consensus         1 S~~~~l~~~v~~f~ifYFliIRPQ~Kr~Ke~~~m~~s   37 (37)
T 2rdd_B            1 SPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDS   37 (37)
T ss_dssp             CCCHHHHHHHHHHHHHHHHTHHHHHHHHHHHTTGGGC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCC
T ss_conf             9188999999999999999957017779999998709




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 108 preprotein tranlocase protein [Candidatus Liberiba
2rdd_B_37 (B:) UPF0092 membrane protein YAJC; drug resistanc 1e-04
>2rdd_B (B:) UPF0092 membrane protein YAJC; drug resistance, multidrug efflux, transporter, antiporter, novel transmembrane helix, ACRB, inner membrane; HET: AIC; 3.50A {Escherichia coli}Length = 37 Back     alignment and structure
 Score = 40.0 bits (94), Expect = 1e-04
 Identities = 8/35 (22%), Positives = 24/35 (68%)

Query: 19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEML 53
          SP+ +  +  V  +++YF+++RPQ+++ +   +++
Sbjct: 1  SPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLM 35


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target108 preprotein tranlocase protein [Candidatus Liberibacter
2rdd_B_37 UPF0092 membrane protein YAJC; drug resistance, mu 99.13
>2rdd_B (B:) UPF0092 membrane protein YAJC; drug resistance, multidrug efflux, transporter, antiporter, novel transmembrane helix, ACRB, inner membrane; HET: AIC; 3.50A {Escherichia coli} Back     alignment and structure
Probab=99.13  E-value=1.6e-11  Score=90.94  Aligned_cols=37  Identities=22%  Similarity=0.726  Sum_probs=34.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             6358999999999999999606128999999999972
Q gi|255764512|r   19 SPLEMAGLFFVLAVVWYFLLIRPQRQQLQRRAEMLRN   55 (108)
Q Consensus        19 ~~~~~l~~~~~~~~i~yF~~iRPq~Kr~k~~~~m~~~   55 (108)
                      |++++++++++++++|||++||||+||+|||++|+++
T Consensus         1 ~~~~~~~~~v~i~~ifYFllIRPQ~Kr~Ke~~~m~~s   37 (37)
T 2rdd_B            1 SPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDS   37 (37)
T ss_dssp             CCCHHHHHHHHHHHHHHHHTHHHHHHHHHHHTTGGGC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHC
T ss_conf             9188999999999999999937217889999998709