254781123

254781123

putative ABC transporter, ATP-binding protein

GeneID in NCBI database:8210148Locus tag:CLIBASIA_05125
Protein GI in NCBI database:254781123Protein Accession:YP_003065536.1
Gene range:+(1125720, 1127552)Protein Length:610aa
Gene description:putative ABC transporter, ATP-binding protein
COG prediction:[R] ATPase components of ABC transporters with duplicated ATPase domains
KEGG prediction:putative ABC transporter, ATP-binding protein
SEED prediction:ABC transporter, ATP-binding protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
ccccEEEEEEEEEEEccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEEEcccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHccccccHHHcccccccccccccccHHEEccEEEEcccccEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccccccccHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEcEEEccccEEEEcccHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccEEEEcccEEHcccccccccccEEEccccEEEEEccccccHHHHHHHHHcccccccccEEEcccEEEEEEccccccccccHHHHHHHHHcHHHHcHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEEEEccEccccccEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEcccEEEEEEcccHHHccccccHHHHHHcccccEEEEcccccHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHEEEcccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MSLPILRLDHISATIGGIDLLQDVclsikpkericlvgcngsgkSTLLKIAAgitepqsgnvflhsssrlgyleqnpdlshfsTISQYIDDTikdtieapyspysllkkfnlreqdrienlsVGQTRCVALMKMLIsrpdilildeptnhldfrTIHWMEQELLKINSALIFVSHDRRFLETLStttvwldrgclhhldQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKitkqyddrlvvkdFSLRIHYgecigivgpngagKTTLLKLLTgkikpdcgfitlgtnlkiatidqkredidpdkslasyltgssgdslmvrgesrhvAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQpfnflimdeptndldfeTLDFLERTITQLQGTILIVshdrdfldrTVTSTIAaqniedpngywikYAGGYSDMLVqqkkshptpqkknppaqslqeETVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHnlkkkneaekewlrygvtarrkrnvrRVKELHEIQKQLQEQKKSFHSTIQTHlqttqssgklvleadkitkqyddrlvVKDFSLRIHYGecigivgpngaGKTTLLKLLTGKIKPDCGFITLGTNLKiatidqkredidpdKSLASyltgssgdslmVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTStiaaqniedpngYWIKYAGGYSDMLVQQKKShptpqkknppaqslqeetvkkekkqkrknrlsysqklllerlpQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNgagkttllklltgkIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVkkekkqkrkNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
*SLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQE*IR*HNLKKKNEAEKEWLRYGVTARRKRNVRRVKEL*****************************KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDM*****************************************QKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLE**Q******
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQ**********************************LSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
*SLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKK**********************RLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKExxxxxxxxxxxxxxxxxxxxxWLTLEIMQEEEKNP
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP
MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTLEIMQEEEKNP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target610 putative ABC transporter, ATP-binding protein [Candidat
254780273539 putative ABC transporter ATP-binding protein [Cand 3e-67
254780273539 putative ABC transporter ATP-binding protein [Cand 7e-20
254780273 539 putative ABC transporter ATP-binding protein [Cand 1e-06
254780718240 putative high-affinity zinc uptake system ATP-bind 6e-17
254780718240 putative high-affinity zinc uptake system ATP-bind 3e-15
254780744262 ABC transporter nucleotide binding/ATPase protein 2e-13
254780744262 ABC transporter nucleotide binding/ATPase protein 2e-09
254780559234 thiamine transporter ATP-binding subunit [Candidat 3e-10
254780559234 thiamine transporter ATP-binding subunit [Candidat 4e-09
254780871227 lipoprotein-releasing system ATP-binding protein l 4e-10
254780871227 lipoprotein-releasing system ATP-binding protein l 1e-07
254780917596 ABC transporter, nucleotide binding/ATPase protein 3e-09
254780917596 ABC transporter, nucleotide binding/ATPase protein 8e-07
254780538280 ABC transporter, nucleotide binding/ATPase protein 6e-09
254780538280 ABC transporter, nucleotide binding/ATPase protein 1e-08
254780596438 ABC transporter nucleotide binding/ATPase protein 2e-08
254780596438 ABC transporter nucleotide binding/ATPase protein 2e-06
254780704254 ABC transporter, nucleotide binding/ATPase protein 5e-08
254780704254 ABC transporter, nucleotide binding/ATPase protein 0.002
254780173257 ABC transporter related protein [Candidatus Liberi 2e-07
254780173257 ABC transporter related protein [Candidatus Liberi 5e-07
254780139257 putative ATP-binding component of ABC transporter 2e-07
254780139257 putative ATP-binding component of ABC transporter 2e-05
254780193528 lipid A ABC exporter family, fused ATPase and inne 3e-05
254780193528 lipid A ABC exporter family, fused ATPase and inne 6e-05
254780576597 ABC transporter related protein [Candidatus Liberi 8e-05
254780576597 ABC transporter related protein [Candidatus Liberi 4e-04
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 1e-04
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 1e-04
254781060249 ABC transporter, nucleotide binding/ATPase protein 2e-04
254781060249 ABC transporter, nucleotide binding/ATPase protein 3e-04
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 5e-04
254780709321 cell division protein [Candidatus Liberibacter asi 0.008
>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score =  247 bits (631), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 162/513 (31%), Positives = 263/513 (51%), Gaps = 53/513 (10%)

Query: 5   ILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL 64
           I  +  +S   G   +L D+ LS  P  +I ++G NG+GKST+L+I AGI +  +G  +L
Sbjct: 6   IYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWL 65

Query: 65  HSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFN------------- 111
            +   +GYL Q P L    T+ + I       IE      ++L ++N             
Sbjct: 66  ATGFTVGYLPQEPQLDLSKTVKENI-------IEGVAHKQAILDRYNELMMNYSEKTEEE 118

Query: 112 -LREQD----------------------------RIENLSVGQTRCVALMKMLISRPDIL 142
             + QD                             I +LS G+ R VAL K+L+S PD+L
Sbjct: 119 IAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLL 178

Query: 143 ILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGF 202
           +LDEPTNHLD  TI WME+ L + + A++ V+HDR FL+ ++   + +DRG        +
Sbjct: 179 LLDEPTNHLDAETIAWMEKYLREYSGAVLMVTHDRYFLDNVTNWILEVDRGKGIPYQGNY 238

Query: 203 AYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTARRKRNVRRVKELHEIQKQLQEQ 262
           + +   K   + QE     + +K  E E++W+     AR+ ++  R++   E+   ++  
Sbjct: 239 SAYLQMKAKRMAQENREEISRQKAIERERDWIVSSPKARQSKSKARIRSYEEL---VESA 295

Query: 263 KKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAG 322
                   Q  +   +  G +V+EA  I+K Y+DRL++ + S ++  G  +G++GPNGAG
Sbjct: 296 AHRHPGNAQIIIPVGKRLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAG 355

Query: 323 KTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGE 382
           KTTL ++LTG   PD G I +G  + ++ +DQ R+ ++ +K++   ++G   D + + G 
Sbjct: 356 KTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGD-DIVKLNGH 414

Query: 383 SRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETL 442
             +   Y   F F        +  LSGG++ R  +A++L    N +++DEPTNDLD ETL
Sbjct: 415 EINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETL 474

Query: 443 DFLERTITQLQGTILIVSHDRDFLDRTVTSTIA 475
             LE  +    G  +I+SHDR FLDR  T  +A
Sbjct: 475 SALEDALENFAGCAVIISHDRMFLDRLATHILA 507

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 90.5 bits (223), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 112/224 (50%), Gaps = 19/224 (8%)

Query: 7   RLDHISATIGGID-------LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQS 59
           RL H+     GI        L+ ++   + P   + ++G NG+GK+TL ++  G   P S
Sbjct: 312 RLGHVVIEAKGISKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDS 371

Query: 60  GNVFLHSSSRLGYLEQNPD-LSHFSTISQYI---DDTIK-DTIEAPYSPYSLLKKFNLR- 113
           G + +  +  L Y++Q+ D L    T+ + I   DD +K +  E     Y     FN + 
Sbjct: 372 GTIHVGETVCLSYVDQSRDSLEAEKTVWEDISGGDDIVKLNGHEINSRAYC--SAFNFKG 429

Query: 114 --EQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALI 171
             +Q RI +LS GQ   V L K+L S  ++++LDEPTN LD  T+  +E  L       +
Sbjct: 430 GDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFAGCAV 489

Query: 172 FVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQ 215
            +SHDR FL+ L+T  +  +     H++     FE ++K+ L +
Sbjct: 490 IISHDRMFLDRLATHILAFEGNG--HVEWFEGNFEEYEKDKLSR 531

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
           K +     ++K +  + V+ D +L  +    IGI+GPNGAGK+T+L+++ G  K   G  
Sbjct: 4   KFIYHMAGLSKVFGSKKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEA 63

Query: 342 TLGTNLKIATIDQK 355
            L T   +  + Q+
Sbjct: 64  WLATGFTVGYLPQE 77

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 80.9 bits (198), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 102/204 (50%), Gaps = 20/204 (9%)

Query: 4   PILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVF 63
           P++ L + S    G  +LQD+  +IKP E + L+G NGSGKST+ K+  GI +P  G+V 
Sbjct: 9   PLISLSNTSFHKNGYKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVK 68

Query: 64  LHSSSRLGYLEQNP--------DLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQ 115
            H    +GY+ Q           L  F T+S     + +D +       +L+ K+N    
Sbjct: 69  RHPQLIVGYVPQKVTIENTLPLSLMRFMTLSM---PSSRDDVLQILDRVNLIGKYN---- 121

Query: 116 DRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKI----NSALI 171
             I++LS G+ +   L K L+ +P++L+LDEP   +DF     + + +  +       ++
Sbjct: 122 RNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCGIL 181

Query: 172 FVSHDRRFLETLSTTTVWL-DRGC 194
            +SH+   +   + T + L +R C
Sbjct: 182 LISHNLHMVMASTDTVICLNNRIC 205

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 94/190 (49%), Gaps = 22/190 (11%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKR-- 356
           +++D +  I   E + ++GPNG+GK+T+ KL+TG IKP  G +     L +  + QK   
Sbjct: 25  ILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLIVGYVPQKVTI 84

Query: 357 EDIDPDKSLASYLT----GSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEK 412
           E+  P  SL  ++T     S  D L +      +  Y ++           +K LSGGE 
Sbjct: 85  ENTLP-LSLMRFMTLSMPSSRDDVLQILDRVNLIGKYNRN-----------IKDLSGGEF 132

Query: 413 MRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGT----ILIVSHDRDFLDR 468
            RA++A+ L +  N L++DEP   +DF     L   IT ++ +    IL++SH+   +  
Sbjct: 133 QRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCGILLISHNLHMVMA 192

Query: 469 TVTSTIAAQN 478
           +  + I   N
Sbjct: 193 STDTVICLNN 202

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 95/204 (46%), Gaps = 16/204 (7%)

Query: 274 LQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGK 333
            Q  ++S   +L A  +TK+Y+   VVK   L +  GE +G++GPNGAGKTT   ++TG 
Sbjct: 15  FQENRASKDSLLSACSLTKKYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGL 74

Query: 334 IKPDCGFITLGTN--LKIATIDQKREDIDPDKSLASYLTGSSGDSLMVR--------GES 383
           I  D G I +  N   K+    + R  I      AS   G + +  ++          + 
Sbjct: 75  ICADSGSIKIDGNDITKMPMYRRARLGISYLPQEASIFRGLTVEENILAVLEVYEKDKKK 134

Query: 384 RH--VAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD--- 438
           RH  +   +K+F       H L   LSGG++ R  +AR L    +++++DEP   +D   
Sbjct: 135 RHEKLDSLLKEFNI-TKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVA 193

Query: 439 FETLDFLERTITQLQGTILIVSHD 462
              +  L R +      ILI  H+
Sbjct: 194 ISDIHVLIRDLASRGIGILITDHN 217

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 93/199 (46%), Gaps = 27/199 (13%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNV----------FLHSSSR 69
           +++ V L +KP E + L+G NG+GK+T   +  G+    SG++           ++  +R
Sbjct: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRAR 99

Query: 70  LG--YLEQNPDLSHFSTISQYIDDTI----KDTIEAPYSPYSLLKKFNLREQDRIEN--L 121
           LG  YL Q   +    T+ + I   +    KD  +      SLLK+FN+ +   +    L
Sbjct: 100 LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLAPLL 159

Query: 122 SVGQTRCVALMKMLISRPDILILDEPTNHLD---FRTIHWMEQELLKINSALIFVSHDRR 178
           S GQ R + + + L+S P  ++LDEP   +D      IH + ++L      ++   H+  
Sbjct: 160 SGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILITDHNVH 219

Query: 179 FLETLSTTTVWLDRGCLHH 197
            + TL      +DR  + H
Sbjct: 220 EILTL------IDRAYIIH 232

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 58.5 bits (140), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 91/191 (47%), Gaps = 14/191 (7%)

Query: 284 VLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL 343
           +++ D +   YD+  +   F  +++  E I I+GP+GAGK+TLL L+ G   P  G I L
Sbjct: 1   MIKLDHLIYCYDN--LKMQFDFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFL 58

Query: 344 GTNLKIATIDQKR--EDIDPDKSLASYLTGSSGDSLMVRGESR---HVAGYIKDFL---F 395
                  +   KR    +  + +L S+LT     +L +    R   +    +K  L   F
Sbjct: 59  NGQNHTRSSPSKRPLSILFQENNLFSHLTVWQNIALGIAPNLRLDHYQHAQVKQMLEKVF 118

Query: 396 HPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLDFLERTITQ 451
             D  +     +SGG++ R  +AR L +    L++DEP    D     E L  L++   +
Sbjct: 119 LEDFFNRFPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDE 178

Query: 452 LQGTILIVSHD 462
            Q T+L++SH+
Sbjct: 179 RQLTLLMISHN 189

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 21/165 (12%)

Query: 5   ILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL 64
           +++LDH+      + +  D    +   ERI ++G +G+GKSTLL + AG   P  G++FL
Sbjct: 1   MIKLDHLIYCYDNLKMQFD--FQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFL 58

Query: 65  H---------SSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQ 115
           +         S   L  L Q  +L    T+ Q I   I   +   +  ++ +K+  + E+
Sbjct: 59  NGQNHTRSSPSKRPLSILFQENNLFSHLTVWQNIALGIAPNLRLDHYQHAQVKQ--MLEK 116

Query: 116 DRIEN--------LSVGQTRCVALMKMLISRPDILILDEPTNHLD 152
             +E+        +S GQ + VAL + LI +  IL+LDEP    D
Sbjct: 117 VFLEDFFNRFPSQMSGGQRQRVALARCLIRQKPILLLDEPFAVFD 161

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 58.2 bits (139), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 21/157 (13%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHS------------- 66
           +L++V LS+K  E + LV  +G+GKST+L IA  +  P  GNV + +             
Sbjct: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84

Query: 67  --SSRLGYLEQNPD-LSHFSTISQYIDDTIKDTIE---APYSPYSLLKKFNLRE--QDRI 118
              S++G++ Q    L  FS I   I   I   I    A      LL   ++ +    R 
Sbjct: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144

Query: 119 ENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRT 155
            ++S G+ + VA+ + + ++P I++ DEPT +LD +T
Sbjct: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 21/194 (10%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKRED 358
           V+++  L +  GE + +V P+G GK+T+L +      PD G + +   L     D K+  
Sbjct: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84

Query: 359 IDPDKSLASY------LTGSSGDSLM---VRGESRHVAGYIK--DFLFHPDQ---AHSLM 404
           +   K    Y      +  S  ++++   +     H   Y +  D L + D    A+   
Sbjct: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144

Query: 405 KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFET----LDFLERTITQLQGTILIVS 460
             +SGGE+ R  + R +A     ++ DEPT +LD +T       L+  + +     LI +
Sbjct: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAT 204

Query: 461 HDRDF---LDRTVT 471
           H+ D    +DR +T
Sbjct: 205 HNHDLASQMDRQIT 218

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 16/179 (8%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQKRE 357
           V+   +L    G+   +VGP+G+GK+T++ LL     P  G I + G N++  T    RE
Sbjct: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRE 427

Query: 358 DID---PDKSLASYLTGSS---GDSLMVRGESRHVA--GYIKDFLFHPDQAHSLM----- 404
            I     D  L S     +   G  +    E   +A      DF+    Q +        
Sbjct: 428 RISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENG 487

Query: 405 KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQL-QG-TILIVSH 461
            +LSGG+K R  +AR + +  + L++DE T+ LD  T + + + +++L QG T ++++H
Sbjct: 488 SNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAH 546

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 25/170 (14%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNV-----------FLHSSS 68
           +L  + L  K  +   LVG +GSGKST++ +   + +P SG++           F     
Sbjct: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRE 427

Query: 69  RLGYLEQNPDLSHFSTISQY------IDDTIKDTIEAPYSP------YSLLKKFNLREQD 116
           R+ Y+ Q  D+  FS   +Y         T ++ IE   S        SL + ++    +
Sbjct: 428 RISYVGQ--DVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGE 485

Query: 117 RIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKI 166
              NLS GQ + +A+ + ++    IL+LDE T+ LD  T + + Q L ++
Sbjct: 486 NGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRL 535

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 103/226 (45%), Gaps = 37/226 (16%)

Query: 274 LQTTQSSGKLVLEADKITKQY-DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332
           ++T  +S K  LE   I+  Y +    ++D +L I       ++G NGAGK+TL + + G
Sbjct: 1   MKTAVASTKGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMG 60

Query: 333 KIKPDCGFI-----TLGTNLK---IATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESR 384
            I  D G I     T+   LK   IA I Q  E ID    +         + +++ G  +
Sbjct: 61  LIPLDKGSISIFNQTVENALKADLIAYIPQT-ESIDWTFPILV-------EDVVMMGRYK 112

Query: 385 HV----AGYIKDFLFHPDQAHSL---------MKHLSGGEKMRAIVARVLAQPFNFLIMD 431
           H+         D+    +   ++         +  LS G++ R  +AR LAQ    +IMD
Sbjct: 113 HMNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMD 172

Query: 432 EPTNDLDFET---LDFLERTITQLQGTILIVSHDRD----FLDRTV 470
           EP   +DF+T   + FL +++      IL+ +H+ +    F DRT+
Sbjct: 173 EPFAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTI 218

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 53.5 bits (127), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 28/216 (12%)

Query: 6   LRLDHISATI-GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL 64
           L L  IS T   G   L+DV L I       L+G NG+GKSTL +   G+     G++ +
Sbjct: 12  LELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISI 71

Query: 65  HSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIE----------------APYSPYSLLK 108
            + +    L+   DL  +   ++ ID T    +E                A  + Y ++ 
Sbjct: 72  FNQTVENALK--ADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVT 129

Query: 109 K------FNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRT---IHWM 159
           +       +   Q +I  LS+GQ + V L + L  +  ++I+DEP   +DF+T   + ++
Sbjct: 130 EALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFL 189

Query: 160 EQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCL 195
            + LL  +  ++  +H+   + +    T++L +  L
Sbjct: 190 LKSLLNEDIMILVSTHNINSIPSFCDRTIFLKKTVL 225

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 77/168 (45%), Gaps = 22/168 (13%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQ 75
           G + +L  V  ++   E + L+G +GSGKSTLL+I AG+  P SG V        G   +
Sbjct: 28  GNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFK-----GKKIK 82

Query: 76  NP--DLS-HFSTISQYIDDTIKDTIEAPYSPYSL---------LKKFNLREQDRIEN--- 120
           +P  D+S  F T + +   T+ + +E       +         L   +L   D  E+   
Sbjct: 83  DPPKDISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLIGLDGFESAHT 142

Query: 121 --LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKI 166
             +S G  + V   +  +  P +L++DEP + LD  T   +  +L+ +
Sbjct: 143 TEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDL 190

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 81/188 (43%), Gaps = 34/188 (18%)

Query: 298 LVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQKR 356
           LV+   +  +  GE +G++G +G+GK+TLL+++ G + P  G +   G  +K        
Sbjct: 31  LVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKKIK-------- 82

Query: 357 EDIDPDK---------SLASYLTGSSGDSLMVRG------ESRHVAGYIKDFLFHPDQAH 401
              DP K         +L  +LT      L ++       E R  A    D +       
Sbjct: 83  ---DPPKDISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLIGLDGFES 139

Query: 402 SLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQL--QG----- 454
           +    +SGG   R   AR      + L+MDEP + LD  T + L   +  L  +G     
Sbjct: 140 AHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIE 199

Query: 455 TILIVSHD 462
           ++L+V+H+
Sbjct: 200 SMLMVTHN 207

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 94/207 (45%), Gaps = 40/207 (19%)

Query: 287 ADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLT--GKIKPDCGF---- 340
           ++K++  Y ++  + D +L+I       ++GP+G GK+T L+ L    +   +C F    
Sbjct: 9   SNKVSVCYGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEI 68

Query: 341 ITLGTNLKIATIDQKR---------EDIDP-DKSLASYLTGSSGDSLMVRGESR------ 384
           I  G N+  +++D  R         +  +P  KS+  Y   + G  +   G ++      
Sbjct: 69  ILDGKNIYQSSVDVVRLRARVGMVFQRPNPFPKSI--YDNVAYGPRIHGLGNNKADIDQI 126

Query: 385 --------HVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTND 436
                    +   +KD LFH          LSGG++ R  +AR LA     ++MDEP + 
Sbjct: 127 VEMSLKKASLFNEVKDRLFHDASL------LSGGQQQRVCIARALAVNPEVILMDEPCSA 180

Query: 437 LDFETLDFLERTITQLQG--TILIVSH 461
           LD      +E  I +L+   TI+IV+H
Sbjct: 181 LDPIATASVEELIHELRESLTIVIVTH 207

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 35.8 bits (81), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 31/198 (15%)

Query: 9   DHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVF----- 63
           + +S   G    L D+ L I       L+G +G GKST L+    + E     VF     
Sbjct: 10  NKVSVCYGEKRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEII 69

Query: 64  -----LHSSS--------RLGYLEQNPD---------LSHFSTISQYIDDT--IKDTIEA 99
                ++ SS        R+G + Q P+         +++   I    ++   I   +E 
Sbjct: 70  LDGKNIYQSSVDVVRLRARVGMVFQRPNPFPKSIYDNVAYGPRIHGLGNNKADIDQIVEM 129

Query: 100 PYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWM 159
                SL  +   R       LS GQ + V + + L   P+++++DEP + LD      +
Sbjct: 130 SLKKASLFNEVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASV 189

Query: 160 EQELLKINSAL--IFVSH 175
           E+ + ++  +L  + V+H
Sbjct: 190 EELIHELRESLTIVIVTH 207

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 99/208 (47%), Gaps = 20/208 (9%)

Query: 283 LVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT 342
             +E   + K Y +   ++D +L +  GE + I GP+G+GK+TL++ +    K   G I 
Sbjct: 16  FAVEIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEII 75

Query: 343 LG---TNLKIATIDQKREDID---PDKSLASYLTGSSGDSL-------MVRGESRHVAGY 389
           +     N  I  I + R D+       +L S L+     +L       M + ++  +A +
Sbjct: 76  INGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMH 135

Query: 390 IKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTI 449
             + +   D++H     LSGGE  RA +AR L      ++ DEPT+ LD E +  +   +
Sbjct: 136 YLNKVKIADKSHRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIM 195

Query: 450 TQL--QG-TILIVSHDRDF----LDRTV 470
            +L  +G T++ V+H+  F     DR V
Sbjct: 196 IELAEEGMTMVCVTHEMGFARQVADRVV 223

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 47.8 bits (112), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 92/204 (45%), Gaps = 29/204 (14%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFL----------- 64
           G    L+D+ L++   ER+ + G +GSGKSTL++    I + Q+G + +           
Sbjct: 28  GNFHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRN 87

Query: 65  -HSSSR-LGYLEQNPDLSHFSTISQYIDDTI----------KDTIEAPYSPYSLLKKFNL 112
            H   R +G + Q+ +L  FS +S   + T+          KD  E      + +K  + 
Sbjct: 88  IHEVRRDVGMVFQHFNL--FSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADK 145

Query: 113 REQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLD---FRTIHWMEQELLKINSA 169
             +           R  A+ + L  +P I++ DEPT+ LD    + +  +  EL +    
Sbjct: 146 SHRSSSLLSGGESQRA-AIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMT 204

Query: 170 LIFVSHDRRFLETLSTTTVWLDRG 193
           ++ V+H+  F   ++   V++D+G
Sbjct: 205 MVCVTHEMGFARQVADRVVFMDQG 228

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 95/213 (44%), Gaps = 32/213 (15%)

Query: 307 IHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI-TLGTNLKIA------TIDQKREDI 359
           I  GE +G++G +G GK+ L++ + G I    G +  LG +L +A          K   +
Sbjct: 36  ILRGEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVL 95

Query: 360 DPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFH---------PDQAHSLMKHLSGG 410
               +L S +T     S+ ++ E  ++   + + + H         P+ A+ +   LSGG
Sbjct: 96  FQHGALFSSMTVQENISMPIK-EHLNLPADLIEHIVHTKIAIVGLPPETANLMPFQLSGG 154

Query: 411 EKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----TILIVSHDRDFL 466
              R  +AR LA   + L +DEPT+ LD    +  ++ + +L+     ++ +++HD + L
Sbjct: 155 MIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHDLNNL 214

Query: 467 DRTVTSTIAAQ-----------NIEDPNGYWIK 488
             T       Q           +I D N  WI+
Sbjct: 215 ISTCNRVAVIQKKGIMKEGTISDIVDSNDPWIR 247

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 27/191 (14%)

Query: 32  ERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHS--------------SSRLGYLEQNP 77
           E + ++G +G+GKS L++   G+    SG V +                S++LG L Q+ 
Sbjct: 40  EILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVLFQHG 99

Query: 78  DLSHFSTISQYIDDTIKDTIEAP--------YSPYSLLKKFNLREQDRIENLSVGQTRCV 129
            L    T+ + I   IK+ +  P        ++  +++             LS G  + V
Sbjct: 100 ALFSSMTVQENISMPIKEHLNLPADLIEHIVHTKIAIVGLPPETANLMPFQLSGGMIKRV 159

Query: 130 ALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSAL----IFVSHD-RRFLETLS 184
           +L + L   PD+L LDEPT+ LD       ++ L+K+  +L      ++HD    + T +
Sbjct: 160 SLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHDLNNLISTCN 219

Query: 185 TTTVWLDRGCL 195
              V   +G +
Sbjct: 220 RVAVIQKKGIM 230

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 30/166 (18%)

Query: 297 RLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQK 355
           R ++K+ +  +  GE I +VG +GAGKT++  L+     P  G + + G +L++ ++++ 
Sbjct: 303 RSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEI 362

Query: 356 REDIDPDKSLASYLTGSSGDSLMV------RGESRHVAGYIKDFLFHPDQAHSLMK---- 405
           R  I         +  S  D++ +      R E ++ A           QAH  +     
Sbjct: 363 RRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAA--------MLAQAHEFIGCLEN 414

Query: 406 -----------HLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFE 440
                      HLS G+  R  +AR + +    L++DE  + LD E
Sbjct: 415 GYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIE 460

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 40.8 bits (94), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 42/203 (20%)

Query: 19  DLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSS-RLGYLEQNP 77
            +L++V  +++P E I LVG +G+GK+++  +     +P SG+V +     RL  LE+  
Sbjct: 304 SILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIR 363

Query: 78  DL-----SHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQ----------------- 115
                   H   I+  + D I   I  P++    ++   +  Q                 
Sbjct: 364 RFIAWVPQHPIMIAASVYDNI--AIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILG 421

Query: 116 DRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDF----------------RTIHWM 159
           D   +LS GQ + +A+ + ++    IL+LDE  + LD                 RT  + 
Sbjct: 422 DGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFA 481

Query: 160 EQELLKINSA-LIFVSHDRRFLE 181
              L  I  A ++FV HD+  +E
Sbjct: 482 SHRLSAIQDADMVFVLHDQVIVE 504

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 40.4 bits (93), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQKRE 357
           + K  S  I   +   ++G +G GK+T+ KLL        G IT+ G ++K  T +  R+
Sbjct: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQ 431

Query: 358 DID--PDKSLA-------SYLTGSSGDSLMVRGESRHVAGYIKDFLFH-PDQAHSLMKH- 406
            I   P  ++        + L G+   S      +  VA  +K F+   P+   +++   
Sbjct: 432 TIGIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQ-LKSFIMKLPNGYDTVVGER 490

Query: 407 ---LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG--TILIVSH 461
              LSGGEK R  +AR + +    +I DE T+ LD  T   ++  +  L    T L+++H
Sbjct: 491 GLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAH 550

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 97/245 (39%), Gaps = 52/245 (21%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSG------------------- 60
           + + +   I P ++  L+G +G GKST+ K+   + + + G                   
Sbjct: 372 IFKGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQ 431

Query: 61  --------NVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLK---K 109
                    +  + + R   L  NP+ S         D  +   +E       ++K    
Sbjct: 432 TIGIIPQDTILFNDTLRYNILYGNPNAS---------DQELCAAVEVAQLKSFIMKLPNG 482

Query: 110 FNLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSA 169
           ++    +R   LS G+ + V++ + ++  P I+I DE T+ LD  T    E+    I +A
Sbjct: 483 YDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIIT----ERH---IQTA 535

Query: 170 LIFVSHDRRFLET---LSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKK 226
           L  +S +R  L     LST T   D   +   DQG        +N++ Q  I     KK+
Sbjct: 536 LATLSKNRTTLVIAHRLSTIT---DADNIIVFDQGTVVESGSHENLISQGGIYTSMWKKQ 592

Query: 227 NEAEK 231
            E+ K
Sbjct: 593 CESIK 597

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 84/221 (38%), Gaps = 71/221 (32%)

Query: 288 DKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNL 347
           DK++ +Y     V   +L +  GE + ++G +GAGK+TLL+ + G               
Sbjct: 34  DKVS-EYGMVSAVIKANLEVKKGEILVLMGLSGAGKSTLLRSING--------------- 77

Query: 348 KIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYI----------------- 390
            +A + +    +D DK    ++   + D+ ++R    H    +                 
Sbjct: 78  -LAPVVRGEVLVDTDKG---FVNPYAADANVLRKLRMHTVSMVFQQFALLPWRTVARNVE 133

Query: 391 --KDFLFHPDQ------------------AHSLMKHLSGGEKMRAIVARVLAQPFNFLIM 430
              +FL  PD                   A   +  LSGG K R   AR  A     L+M
Sbjct: 134 LGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKINMLSGGMKQRVGFARAFATGAPILLM 193

Query: 431 DEPTNDLDFETLDFLERTITQ---------LQGTILIVSHD 462
           DEP     F +LD L R   Q         L+ TI+ VSHD
Sbjct: 194 DEP-----FSSLDPLIRMRLQDELLALQRKLKKTIVFVSHD 229

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 77/188 (40%), Gaps = 45/188 (23%)

Query: 26  LSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDLSHFSTI 85
           L +K  E + L+G +G+GKSTLL+   G+     G V + +    G++  NP    ++  
Sbjct: 50  LEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDK--GFV--NP----YAAD 101

Query: 86  SQYIDDTIKDTIEAPYSPYSLL----------------------KKFNLREQDRIENL-- 121
           +  +      T+   +  ++LL                      +K  + E   I NL  
Sbjct: 102 ANVLRKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTK 161

Query: 122 ---------SVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELL----KINS 168
                    S G  + V   +   +   IL++DEP + LD      ++ ELL    K+  
Sbjct: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221

Query: 169 ALIFVSHD 176
            ++FVSHD
Sbjct: 222 TIVFVSHD 229

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 81/209 (38%), Gaps = 46/209 (22%)

Query: 19  DLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAG--ITEPQSGNVFLHSSSRLGYLEQN 76
           ++++ + L ++P E + ++G NGSGKSTL  + +G    E  +G++     S L      
Sbjct: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESIL------ 70

Query: 77  PDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIEN---------------- 120
            D S     S+ I    +  +E P        K  L EQ +  N                
Sbjct: 71  -DWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKI 129

Query: 121 ------------------LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQE 162
                              S G+ +   +++M +  P + ILDE  + LD   +    Q 
Sbjct: 130 TAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQG 189

Query: 163 LLKINS---ALIFVSHDRRFLETLSTTTV 188
           +  + S   + + ++H +R L  +   T+
Sbjct: 190 VNALRSQDRSFLIITHYQRLLNYIKPDTI 218

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 38.5 bits (88), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 296 DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332
           D  +++  +L++   E + I+GPNG+GK+TL  LL+G
Sbjct: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG 51

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 37.7 bits (86), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 270 IQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKL 329
           I   L     + K ++  DK T     RL+ ++ S  I  G C  I GP+G GK+  L  
Sbjct: 322 ISMRLSNNTITAKNIVFRDKKT----SRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLC 377

Query: 330 LTGKIKPDCGFITLG-----------TNLKIATIDQKREDIDPDKSLASYLTGSSGDSLM 378
           + G +  + G I+ G            + +I  + Q    + P     + +     +SL 
Sbjct: 378 MLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQ-HCSLFPISITENIILSHDQNSLH 436

Query: 379 VRGESRHVAGYIKDFLFHPD--QAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTND 436
           +  ++  + G  +D L   +  Q       +      +  ++R++A     L+MDEP   
Sbjct: 437 IAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYH 496

Query: 437 LDFETLDFLERTITQL---QGTILIVSHD 462
           LD E  +     + Q    + TI+I+SHD
Sbjct: 497 LDNEAKNNFYTLLKQFKENKKTIVIISHD 525

>gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Back     alignment
 Score = 33.9 bits (76), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 302 DFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGF---ITLGTNLKIATIDQKRED 358
           DFS R H    I +VG NG GKTT++  L+ K+  D G    +  G   + A IDQ +  
Sbjct: 106 DFSHRPH---VILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLK-- 159

Query: 359 IDPDKSLASYLTGSSG 374
           I  D++ A ++    G
Sbjct: 160 IWADRTSADFVCSEIG 175

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target610 putative ABC transporter, ATP-binding protein [Candidat
315122587608 putative ABC transporter, ATP-binding protein [Candidat 1 0.0
86359610606 putative ABC transporter, ATP-binding protein [Rhizobiu 1 1e-179
222087721609 ABC transporter [Agrobacterium radiobacter K84] Length 1 1e-178
327191750606 putative ABC transporter, ATP-binding protein [Rhizobiu 1 1e-176
209551379606 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 1e-175
15889968608 ABC transporter, nucleotide binding/ATPase protein [Agr 1 1e-175
116254335605 ATP-binding component of ABC transporter [Rhizobium leg 1 1e-175
190893884606 ABC transporter ATP-binding protein [Rhizobium etli CIA 1 1e-174
241206821605 ABC transporter [Rhizobium leguminosarum bv. trifolii W 1 1e-174
150398298608 ABC transporter-like protein [Sinorhizobium medicae WSM 1 1e-174
>gi|315122587|ref|YP_004063076.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 608 Back     alignment and organism information
 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/609 (76%), Positives = 532/609 (87%), Gaps = 4/609 (0%)

Query: 1   MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSG 60
           M+LPILRLDHI+ATIGGI+LLQD+ LS+KP+ERICLVGCNGSGKSTLLKIAAGI EPQSG
Sbjct: 1   MNLPILRLDHINATIGGINLLQDISLSVKPRERICLVGCNGSGKSTLLKIAAGIIEPQSG 60

Query: 61  NVFLHSSSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQDRIEN 120
            VFL+S   LGYLEQNPD SHFSTIS +I+   KD+ E  YS  S LKKFNL E+D+I +
Sbjct: 61  TVFLNSPHTLGYLEQNPDFSHFSTISDFINCN-KDSTEFSYSLNSFLKKFNLTEKDKISH 119

Query: 121 LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFL 180
           LSVGQ RCVAL+KMLI RPDILILDEPTNHLD RTIHWMEQELL INS+LIFVSHDR FL
Sbjct: 120 LSVGQARCVALIKMLILRPDILILDEPTNHLDSRTIHWMEQELLNINSSLIFVSHDRFFL 179

Query: 181 ETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWLRYGVTA 240
           +TLST T+WLDRGCLHHL++GF++FE WKK+ILQQEQ  YHNLKKKNEAE+EWLRYGVTA
Sbjct: 180 KTLSTATIWLDRGCLHHLNKGFSFFEPWKKSILQQEQAHYHNLKKKNEAEEEWLRYGVTA 239

Query: 241 RRKRNVRRVKELHEIQKQLQEQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVV 300
           RRKRNVRRVKEL +I+ QLQEQK SFH TIQ HLQ+TQSSGKLV+EADKITK+Y+D  +V
Sbjct: 240 RRKRNVRRVKELQDIRTQLQEQKSSFHGTIQAHLQSTQSSGKLVIEADKITKKYNDNFIV 299

Query: 301 KDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKREDID 360
           K+FSLRIH GE IGIVGPNGAGKTTLLKLLTGKI+PD G ITLGTNLKIA IDQKREDI+
Sbjct: 300 KNFSLRIHCGERIGIVGPNGAGKTTLLKLLTGKIQPDSGSITLGTNLKIAIIDQKREDIN 359

Query: 361 PDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARV 420
           P++SL+SYLTG  GDSL+V+GESRHV GYIKDFLFHPDQAHSL+K LSGGEKMRAI+ARV
Sbjct: 360 PNESLSSYLTGGYGDSLLVQGESRHVVGYIKDFLFHPDQAHSLIKDLSGGEKMRAILARV 419

Query: 421 LAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTVTSTIAAQNIE 480
           LAQPFNFL+MDEPTNDLDFETLDFLE+TIT+ QGTILIVSHDRDFLDRTV ST++ QN++
Sbjct: 420 LAQPFNFLVMDEPTNDLDFETLDFLEQTITRFQGTILIVSHDRDFLDRTVNSTLSMQNVD 479

Query: 481 DPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSLQEETVKKEKKQKRKNRLSYSQKL 540
           + NG WIKYAGGYSDML+QQK+++  PQKKNPP +S    T KK+KK+K    LSY QKL
Sbjct: 480 NHNGCWIKYAGGYSDMLLQQKQNNNIPQKKNPPTESAIPSTTKKDKKKK---SLSYGQKL 536

Query: 541 LLERLPQEIHKIQLKITEKEQQINDQNLISNEGKEIHQLYHDLDQMYQDVKEKEEQWLTL 600
           LLE+LPQEI KI LKITEKEQQ NDQNL   + K+  +L H+L  +Y ++KEKEE+WL L
Sbjct: 537 LLEKLPQEIKKIHLKITEKEQQFNDQNLFLKDAKKFSKLSHELKNLYHEIKEKEEKWLEL 596

Query: 601 EIMQEEEKN 609
           E++QEE K+
Sbjct: 597 EMLQEEVKD 605


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359610|ref|YP_471502.1| putative ABC transporter, ATP-binding protein [Rhizobium etli CFN 42] Length = 606 Back     alignment and organism information
>gi|222087721|ref|YP_002546258.1| ABC transporter [Agrobacterium radiobacter K84] Length = 609 Back     alignment and organism information
>gi|327191750|gb|EGE58752.1| putative ABC transporter, ATP-binding protein [Rhizobium etli CNPAF512] Length = 606 Back     alignment and organism information
>gi|209551379|ref|YP_002283296.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 606 Back     alignment and organism information
>gi|15889968|ref|NP_355649.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium tumefaciens str. C58] Length = 608 Back     alignment and organism information
>gi|116254335|ref|YP_770173.1| ATP-binding component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 605 Back     alignment and organism information
>gi|190893884|ref|YP_001980426.1| ABC transporter ATP-binding protein [Rhizobium etli CIAT 652] Length = 606 Back     alignment and organism information
>gi|241206821|ref|YP_002977917.1| ABC transporter [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 605 Back     alignment and organism information
>gi|150398298|ref|YP_001328765.1| ABC transporter-like protein [Sinorhizobium medicae WSM419] Length = 608 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target610 putative ABC transporter, ATP-binding protein [Candidat
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 1e-119
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 2e-45
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 3e-85
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 2e-83
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 1e-51
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 3e-43
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 3e-36
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 4e-33
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 1e-28
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-115
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 5e-54
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 3e-26
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 2e-44
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 9e-19
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-15
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 3e-12
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 7e-08
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 9e-38
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 2e-27
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-25
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 3e-25
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 4e-25
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 2e-24
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 6e-24
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 5e-23
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 1e-22
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 1e-22
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 4e-22
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 1e-21
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 2e-21
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 3e-21
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 3e-21
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 5e-21
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 6e-21
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 8e-21
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 8e-21
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 9e-21
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 1e-20
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 2e-20
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 4e-20
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 7e-20
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 1e-19
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 2e-19
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 2e-19
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 2e-19
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 2e-19
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 3e-19
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 5e-19
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 9e-19
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 1e-18
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 1e-18
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 1e-18
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-18
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 4e-18
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine transport 5e-18
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 6e-18
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 6e-18
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 6e-18
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 9e-18
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 9e-18
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 1e-17
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 1e-17
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 6e-17
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 7e-17
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 8e-17
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 1e-16
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 1e-16
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 1e-16
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 1e-16
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 1e-16
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 1e-16
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 2e-16
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 2e-16
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 2e-16
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 3e-16
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 3e-16
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 4e-16
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 6e-16
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 7e-16
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 1e-15
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 1e-15
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 1e-15
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 1e-15
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 1e-15
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 2e-15
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 2e-15
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 2e-15
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 2e-15
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 2e-15
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 3e-15
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 3e-15
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 5e-15
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 5e-15
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 6e-15
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 6e-15
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 7e-15
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 9e-15
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 1e-14
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 1e-14
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 1e-14
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 2e-14
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-14
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 2e-14
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 3e-14
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 3e-14
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 3e-14
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 4e-14
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 4e-14
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 5e-14
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 6e-14
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 7e-14
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 1e-13
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 1e-13
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 1e-13
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 1e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 1e-13
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 1e-13
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 1e-13
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 2e-13
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 2e-13
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 3e-13
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 3e-13
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 3e-13
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 3e-13
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 3e-13
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 4e-13
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 4e-13
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 5e-13
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 7e-13
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 7e-13
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 7e-13
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 9e-13
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 9e-13
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 1e-12
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 1e-12
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 2e-12
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 2e-12
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 2e-12
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 2e-12
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 2e-12
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 3e-12
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 3e-12
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding subu 3e-12
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 3e-12
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 4e-12
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 5e-12
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 5e-12
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine transpo 5e-12
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 5e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 5e-12
COG4148352 COG4148, ModC, ABC-type molybdate transport system, ATP 6e-12
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 6e-12
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 7e-12
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 8e-12
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 1e-11
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 1e-11
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 1e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 1e-11
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 1e-11
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 1e-11
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 1e-11
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 1e-11
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 2e-11
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 2e-11
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-11
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 2e-11
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 2e-11
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 3e-11
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 3e-11
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 3e-11
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 3e-11
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 3e-11
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 4e-11
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 4e-11
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 4e-11
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 4e-11
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 5e-11
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 8e-11
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 9e-11
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-10
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 1e-10
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 1e-10
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 1e-10
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 2e-10
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 2e-10
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 2e-10
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 2e-10
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 2e-10
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 2e-10
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 3e-10
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 3e-10
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 4e-10
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 4e-10
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 5e-10
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 5e-10
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 5e-10
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 1e-09
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 1e-09
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 1e-09
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 2e-09
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 2e-09
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 2e-09
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 4e-09
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 4e-09
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 4e-09
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 4e-09
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 4e-09
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 4e-09
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 4e-09
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 5e-09
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 5e-09
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 6e-09
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 6e-09
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 6e-09
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 7e-09
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 7e-09
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 7e-09
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding prote 7e-09
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 8e-09
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 9e-09
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 9e-09
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 9e-09
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 9e-09
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 1e-08
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 1e-08
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 2e-08
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 2e-08
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 3e-08
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 4e-08
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 4e-08
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 6e-08
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 6e-08
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 7e-08
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 9e-08
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 1e-07
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 1e-07
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-07
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 2e-07
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 2e-07
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 2e-07
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 2e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 2e-07
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 3e-07
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 4e-07
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 4e-07
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 4e-07
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transporter 5e-07
PRK10070400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 5e-07
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 6e-07
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 8e-07
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 1e-06
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 1e-06
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 2e-06
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 2e-06
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 3e-06
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 3e-06
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 5e-06
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 5e-06
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 5e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 8e-06
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 8e-06
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 8e-06
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 9e-06
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 9e-06
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 2e-05
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 2e-05
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 3e-05
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 5e-05
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 5e-05
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 6e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 8e-05
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 8e-05
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 8e-05
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 8e-05
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-04
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 1e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 1e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 1e-04
COG3910233 COG3910, COG3910, Predicted ATPase [General function pr 2e-04
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 2e-04
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 2e-04
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 3e-04
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 3e-04
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 3e-04
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 3e-04
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 4e-04
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 5e-04
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 8e-04
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 0.001
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 0.002
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 0.002
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 0.003
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 0.003
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 0.003
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 6e-37
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 3e-33
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 2e-26
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 2e-24
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 3e-24
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 3e-24
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 6e-24
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 5e-23
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 7e-23
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine transport 9e-23
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 4e-22
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 1e-21
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 1e-21
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 1e-21
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 1e-21
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 3e-21
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 3e-21
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 1e-20
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 2e-20
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 2e-20
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 3e-20
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 5e-20
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 1e-19
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 1e-19
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 1e-19
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 2e-19
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 1e-18
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 4e-18
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 4e-18
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 5e-18
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 6e-18
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 1e-17
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 1e-17
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-17
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 1e-17
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 1e-17
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 5e-17
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 6e-17
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 7e-17
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 1e-16
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 1e-16
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 1e-16
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 2e-16
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 3e-16
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 4e-16
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 2e-15
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 2e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 4e-15
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 5e-15
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 8e-15
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 9e-15
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 9e-15
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 2e-14
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 5e-14
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 6e-14
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 7e-14
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 7e-14
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 7e-14
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 8e-14
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 1e-13
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 1e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 2e-13
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 3e-13
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 5e-13
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 6e-13
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 9e-13
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 2e-12
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 2e-12
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 2e-12
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 3e-12
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 3e-12
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 4e-12
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 9e-12
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 1e-11
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding subu 1e-11
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 2e-11
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-11
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 2e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 5e-11
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 6e-11
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 1e-10
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 2e-10
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 2e-10
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 3e-10
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 6e-10
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 8e-10
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 1e-09
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 2e-09
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 2e-09
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 2e-09
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 2e-09
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 2e-09
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 3e-09
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 3e-09
COG4148352 COG4148, ModC, ABC-type molybdate transport system, ATP 4e-09
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 4e-09
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 4e-09
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 5e-09
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 6e-09
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 7e-09
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 8e-09
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 8e-09
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 8e-09
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 1e-08
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 2e-08
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 3e-08
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 3e-08
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 3e-08
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 4e-08
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 6e-08
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 7e-08
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 9e-08
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 1e-07
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 1e-07
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 1e-07
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-07
KOG00651391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 4e-07
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 5e-07
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-06
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 1e-06
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 1e-06
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 1e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 3e-06
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 9e-06
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 2e-05
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 3e-05
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 5e-05
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 5e-05
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 6e-05
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 1e-04
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 1e-04
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 2e-04
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 3e-04
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 8e-04
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 9e-04
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisional 0.001
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 0.001
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 0.002
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 0.002
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 0.002
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 0.003
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 3e-25
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 7e-12
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 6e-25
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 2e-21
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 2e-20
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 1e-19
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 2e-19
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 3e-19
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 7e-18
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 1e-17
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 1e-17
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 5e-17
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 9e-17
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 1e-16
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-16
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 2e-16
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 6e-16
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 9e-16
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 9e-16
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 2e-15
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 3e-15
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 4e-15
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 5e-15
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 8e-15
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 8e-15
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 1e-14
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 2e-14
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 2e-14
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 2e-14
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 3e-14
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 3e-14
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 3e-14
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 4e-14
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 5e-14
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 6e-14
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 6e-14
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 6e-14
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 1e-13
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 2e-13
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 2e-13
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 2e-13
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 4e-13
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 6e-13
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 7e-13
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 9e-13
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 1e-12
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 1e-12
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 2e-12
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 2e-12
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 2e-12
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 2e-12
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 3e-12
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 3e-12
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 3e-12
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 4e-12
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 5e-12
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 6e-12
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 9e-12
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 1e-11
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 2e-11
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 2e-11
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 2e-11
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 3e-11
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 3e-11
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 3e-11
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 4e-11
KOG0061613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 4e-11
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 4e-11
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 6e-11
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 6e-11
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 8e-11
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 1e-10
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 1e-10
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 2e-10
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 2e-10
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 2e-10
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 2e-10
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 3e-10
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 3e-10
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 4e-10
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 5e-10
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 5e-10
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 8e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 1e-09
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 1e-09
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 2e-09
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 2e-09
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 2e-09
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 3e-09
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 3e-09
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 4e-09
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 4e-09
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 4e-09
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 6e-09
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 7e-09
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 9e-09
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine transpo 1e-08
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 1e-08
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 1e-08
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 2e-08
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 2e-08
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 3e-08
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 3e-08
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 3e-08
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 3e-08
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 8e-08
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 9e-08
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 1e-07
PLN031301622 PLN03130, PLN03130, ABC transporter C family member; Pr 1e-07
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 1e-07
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 1e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 2e-07
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 2e-07
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 2e-07
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 2e-07
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 3e-07
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 3e-07
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 4e-07
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 4e-07
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 6e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 6e-07
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 7e-07
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 8e-07
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 8e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 8e-07
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 9e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 9e-07
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-binding / 1e-06
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 2e-06
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 3e-06
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 3e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 3e-06
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 3e-06
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 5e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 6e-06
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 8e-06
PRK10070400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 8e-06
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 9e-06
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 9e-06
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 9e-06
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 1e-05
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding prote 2e-05
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 2e-05
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 2e-05
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 2e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 2e-05
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 3e-05
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 3e-05
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 5e-05
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 6e-05
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 7e-05
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 9e-05
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 1e-04
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 1e-04
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 3e-04
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 6e-04
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 8e-04
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 0.001
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 0.001
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 0.001
cd03288257 cd03288, ABCC_SUR2, The SUR domain 2 0.002
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 0.002
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.002
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 0.003
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 0.004
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 0.004
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 0.004
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 2e-21
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 1e-18
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 3e-16
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 1e-14
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 2e-10
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 2e-16
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 1e-15
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 2e-06
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 5e-06
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 1e-15
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 1e-10
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 3e-08
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 1e-07
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 3e-07
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 5e-07
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 9e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 1e-06
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 2e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 2e-06
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 3e-06
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 3e-05
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 2e-04
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 2e-04
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 4e-04
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 0.001
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 0.002
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 0.002
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 0.002
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding protein 0.003
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 0.004
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-13
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 8e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-04
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 6e-13
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 4e-11
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 3e-09
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 1e-08
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transporter 9e-13
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 4e-05
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 4e-12
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 0.002
pfam00005119 pfam00005, ABC_tran, ABC transporter 5e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 7e-10
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 9e-10
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 3e-07
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 3e-06
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 7e-05
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 1e-04
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 2e-09
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 2e-07
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 2e-07
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 7e-06
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 3e-08
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 1e-04
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 0.002
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 0.002
PRK13545549 PRK13545, tagH, teichoic acids export protein ATP-bindi 0.003
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 0.004
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 9e-08
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 3e-05
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 5e-06
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 5e-06
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 5e-06
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 8e-06
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 2e-05
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 2e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 4e-05
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 6e-05
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 6e-05
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 7e-05
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 9e-05
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 1e-04
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 1e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 2e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 2e-04
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 2e-04
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 3e-04
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 3e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 3e-04
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 4e-04
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 5e-04
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 0.001
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 0.001
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 0.002
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 0.003
PRK01156895 PRK01156, PRK01156, chromosome segregation protein; Pro 0.003
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 0.003
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 0.003
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 0.004
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 6e-06
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 6e-04
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transporter A 1e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 9e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 3e-04
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 3e-04
PRK12608380 PRK12608, PRK12608, transcription termination factor Rh 2e-05
>gnl|CDD|182996 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|183324 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|35285 KOG0062, KOG0062, KOG0062, ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism, Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35289 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|185024 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|178622 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea