254781130

254781130

hypothetical protein CLIBASIA_05160

GeneID in NCBI database:8210155Locus tag:CLIBASIA_05160
Protein GI in NCBI database:254781130Protein Accession:YP_003065543.1
Gene range:-(1132630, 1133766)Protein Length:378aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD
ccccEEEEEEEccccccccccccHHHHHHHHHHHHccccccccccccccccccEEEEEEEccccccccccccHHHHHHcccccccccccccccccEEEEEEcccEEEEEEEHHHHHHHHHHcccHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHEEEEccccEEEEEcHHHHHHHHHHHHHHcccEEcccccccHHHHHccccccccEEEEEcccccccHHHHccHHHHHHHHcccccHHHHHHHHccccccccccccccccHHHEEEccccccHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccc
cccEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccccccccccHcHHHEEEEccccccccHccccHEEEEccccccccccccccccccEEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHccccEEccccEEEEEEccccEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEccccccccccHEccHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccccccccc
mprirevyilpagsqaypnsnissSAYNNLLKdlaldnnsprpisaggtaaDNAVQARVNlgtddasnltkGKIIAnllpfypiqqgggigqldnkiylgwngTQLLLQVDLSSMrevwtsqlapRALQNLvdhahkpnhivyttdsnqyaatpLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFlddgdimcyKRQKTVWQGIEIAQHTANIALEStknclykttvlnmgrgpgyihfdtdkgavgcsyflsderlkkvhgesSASAREIIEQLKFidfnylpesgmdseLRYLIGFSENNLKEINEVFVDtiggylapnpsviIPHLAKAIQELLQEVKELRDMIDKQneehqdvqdmsntplnsqkfd
MPRIREVyilpagsqaypnsNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNeehqdvqdmsntplnsqkfd
MPRIREVYILPAGSQAYPNSNISSSAYnnllkdlaldnnSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD
*****EVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQ*********************************
MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLK********SAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQ***********NTPLNSQKFD
*PRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEE******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNTPLNSQKFD
MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD
MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVNLGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWTSQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGAQFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALESTKNCLYKTTVLNMGRGPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSELRYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTPLNSQKFD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
315122525360 hypothetical protein CKC_03885 [Candidatus Liberibacter 1 1e-148
150397017 499 hypothetical protein Smed_1814 [Sinorhizobium medicae W 1 7e-08
227821710 506 hypothetical protein NGR_c11420 [Sinorhizobium fredii N 1 2e-07
3028736971163 phage minor structural protein [Clostridium cellulovora 1 3e-07
319783524403 hypothetical protein Mesci_3833 [Mesorhizobium ciceri b 1 3e-06
227822432403 hypothetical protein NGR_c18870 [Sinorhizobium fredii N 1 7e-06
330970689780 tail fiber protein H [Pseudomonas syringae pv. aceris s 1 2e-05
301386028780 tail fiber protein H, putative [Pseudomonas syringae pv 1 8e-05
308187194468 hypothetical protein Pvag_1688 [Pantoea vagans C9-1] Le 1 4e-04
299068824359 putative side tail fiber protein (Fragment) [Ralstonia 1 4e-04
>gi|315122525|ref|YP_004063014.1| hypothetical protein CKC_03885 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 360 Back     alignment and organism information
 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 258/360 (71%), Positives = 304/360 (84%), Gaps = 1/360 (0%)

Query: 1   MPRIREVYILPAGSQAYPNSNISSSAYNNLLKDLALDNNSPRPISAGGTAADNAVQARVN 60
           MPRI+EVYI+P+GS+AYPNSNISSSAYNNLL+DLALDNN PRPI AGGT A NA QAR+N
Sbjct: 1   MPRIKEVYIIPSGSKAYPNSNISSSAYNNLLEDLALDNNQPRPICAGGTGAANASQARIN 60

Query: 61  LGTDDASNLTKGKIIANLLPFYPIQQGGGIGQLDNKIYLGWNGTQLLLQVDLSSMREVWT 120
           LG DDA+NLTKGKIIA LLPFYPIQQGGG GQLDNKIYLGWNG  LLLQVD      VWT
Sbjct: 61  LGMDDANNLTKGKIIATLLPFYPIQQGGGKGQLDNKIYLGWNGKNLLLQVDQQLQGVVWT 120

Query: 121 SQLAPRALQNLVDHAHKPNHIVYTTDSNQYAATPLSSFMRKLFSCHNGETLHQAIFQNGA 180
           SQLAP ALQ+LV HA K NHIVYT DSN+YA+TPLSSF+R+LF+C N E LH+AIF+NGA
Sbjct: 121 SQLAPLALQSLVSHAEKANHIVYTADSNKYASTPLSSFVRELFACKNNEELHKAIFKNGA 180

Query: 181 QFYNNSQRIAAFLDDGDIMCYKRQKTVWQGIEIAQHTANIALEST-KNCLYKTTVLNMGR 239
           +FYNN+ +IA F++DGDI C+ R KT+WQGI+ AQ+TAN+A++   K  + KTTVLNM R
Sbjct: 181 KFYNNTNKIAEFMNDGDIFCHPRNKTMWQGIDSAQYTANLAIDLIPKQYIKKTTVLNMER 240

Query: 240 GPGYIHFDTDKGAVGCSYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSEL 299
             GYIHFDTD GAVGC+YF+SDERLK++HG+SSAS+ ++IE+ KFIDF+YLP SGMDS L
Sbjct: 241 SQGYIHFDTDMGAVGCNYFISDERLKEIHGKSSASSLDLIEKFKFIDFSYLPSSGMDSSL 300

Query: 300 RYLIGFSENNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNE 359
           RY IGFS NNL+EIN++ VD IG YL+PNPSVI+P+L KAIQEL  EVKELR  I +Q +
Sbjct: 301 RYPIGFSANNLQEINDILVDKIGDYLSPNPSVILPYLCKAIQELSAEVKELRRRIHQQKD 360


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397017|ref|YP_001327484.1| hypothetical protein Smed_1814 [Sinorhizobium medicae WSM419] Length = 499 Back     alignment and organism information
>gi|227821710|ref|YP_002825680.1| hypothetical protein NGR_c11420 [Sinorhizobium fredii NGR234] Length = 506 Back     alignment and organism information
>gi|302873697|ref|YP_003842330.1| phage minor structural protein [Clostridium cellulovorans 743B] Length = 1163 Back     alignment and organism information
>gi|319783524|ref|YP_004143000.1| hypothetical protein Mesci_3833 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 403 Back     alignment and organism information
>gi|227822432|ref|YP_002826404.1| hypothetical protein NGR_c18870 [Sinorhizobium fredii NGR234] Length = 403 Back     alignment and organism information
>gi|330970689|gb|EGH70755.1| tail fiber protein H [Pseudomonas syringae pv. aceris str. M302273PT] Length = 780 Back     alignment and organism information
>gi|301386028|ref|ZP_07234446.1| tail fiber protein H, putative [Pseudomonas syringae pv. tomato Max13] Length = 780 Back     alignment and organism information
>gi|308187194|ref|YP_003931325.1| hypothetical protein Pvag_1688 [Pantoea vagans C9-1] Length = 468 Back     alignment and organism information
>gi|299068824|emb|CBJ40065.1| putative side tail fiber protein (Fragment) [Ralstonia solanacearum CMR15] Length = 359 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
KOG3661 1019 KOG3661, KOG3661, KOG3661, Uncharacterized conserved pr 9e-04
>gnl|CDD|38865 KOG3661, KOG3661, KOG3661, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
KOG3661 1019 consensus 99.73
pfam03962188 Mnd1 Mnd1 family. This family of proteins includes MND1 94.67
cd04769116 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2- 91.97
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslational 90.68
PRK09343122 prefoldin subunit beta; Provisional 90.06
pfam05529192 Bap31 B-cell receptor-associated protein 31-like. Bap31 90.27
>KOG3661 consensus Back     alignment and domain information
>pfam03962 Mnd1 Mnd1 family Back     alignment and domain information
>cd04769 HTH_MerR2 Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>pfam05529 Bap31 B-cell receptor-associated protein 31-like Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
3gud_A129 Crystal Structure Of A Novel Intramlolecular Chaper 8e-06
>gi|285803215|pdb|3GUD|A Chain A, Crystal Structure Of A Novel Intramlolecular Chaperon Length = 129 Back     alignment and structure
 Score = 56.2 bits (133), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 28/77 (36%), Gaps = 7/77 (9%)

Query: 260 SDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMD-SELRYLIGFSENNLKEINEVFV 318
           SDER K      S    +  E++KF  + +         E RY  G     + ++ E   
Sbjct: 1   SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFED-- 58

Query: 319 DTIGGYLAPNPSVIIPH 335
               G  A +   ++ +
Sbjct: 59  ---EGLSAFDYG-LVGY 71


Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
3gw6_A275 Endo-N-acetylneuraminidase; chaperone, glycosidase, hyd 99.8
3gud_A129 NECK appendage protein; 3-helix bundle, chaperon, chape 99.53
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 95.72
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 93.46
3ghg_B 461 Fibrinogen beta chain; triple-stranded coiled coil, bet 93.77
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coil, be 92.24
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rings, f 91.61
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clotting; 91.08
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, DNA, 92.89
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, DNA, 91.57
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcription, 90.8
>3gw6_A Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F} Back     alignment and structure
Probab=99.80  E-value=4.5e-20  Score=172.47  Aligned_cols=101  Identities=10%  Similarity=0.121  Sum_probs=79.3

Q ss_pred             EEEEHHHHHHHHHCCCCCHHHHHHHHHCCEEEEECCCCC-CCCCCCEEEEEEHHHHHHHHHHHEE---------------
Q ss_conf             998703776642111452077898620725888535457-7854340232557888766334410---------------
Q gi|254781130|r  256 SYFLSDERLKKVHGESSASAREIIEQLKFIDFNYLPESG-MDSELRYLIGFSENNLKEINEVFVD---------------  319 (378)
Q Consensus       256 ~~~~SD~rlK~~i~~~~~~~l~~i~~l~~~~~~~~~~~~-~~~~~~~~~G~iAqev~~v~p~~v~---------------  319 (378)
                      +..+||+|+|+||+++...+|++|++|||++|+||+... ..+..+.++|||||||++++|+..-               
T Consensus       118 ~~~tSD~r~K~~i~~~~~~~l~~i~~l~~~~f~w~~~~~~~~~~~~~~~G~iAqev~~~~~~~g~~~~~~d~~~y~~~~~  197 (275)
T 3gw6_A          118 PIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSTNCRYAVLCY  197 (275)
T ss_dssp             CEEECTTCCBCCCBCCCHHHHHHHTTCCCEEECBHHHHHHHGGGSCBEEECCHHHHHHHHHHTTSSCSCC--CCBTTEEE
T ss_pred             CCEEECCCCCCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCEECCCCC
T ss_conf             32011333035766688899999983795798865543346776542136631278888775177767776210221116


Q ss_pred             ----------------------------------------CCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----------------------------------------6766031367775999999999999999999999999999
Q gi|254781130|r  320 ----------------------------------------TIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNE  359 (378)
Q Consensus       320 ----------------------------------------~~~~~~~~~~~~l~~~li~aiqel~~~i~~l~~~i~~~~~  359 (378)
                                                              ..+..++|+|++|+| |++|+||  +||++|+.||+.|..
T Consensus       198 d~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~ygiry~el~~-l~~A~qe--~~i~~LeaRi~aLE~  274 (275)
T 3gw6_A          198 DKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFF-AEAAYQR--RKLERIEARLSALEQ  274 (275)
T ss_dssp             EEECCEEEEEEEEEEEEEEECSSSCEEEEEEEEEEEEEEECCEEEEEECHHHHHH-HHHHHHH--HHHHHHHHHHHTTTC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH-HHHHHHH--HHHHHHHHHHHHHCC
T ss_conf             6540214542233332211124456433444442211134552252187999999-9999999--999999999998628



>3gud_A NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, alternative splicing, amyloid, amyloidosis, blood coagulation, coiled coil; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [TaxId 92.09
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 91.01
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=92.09  E-value=0.4  Score=25.28  Aligned_cols=60  Identities=12%  Similarity=0.072  Sum_probs=44.9

Q ss_pred             HHHHHHHHHHEECCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8887663344106766031367775999999999999999999999999999999999998755
Q gi|254781130|r  308 NNLKEINEVFVDTIGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMIDKQNEEHQDVQDMSNTP  371 (378)
Q Consensus       308 qev~~v~p~~v~~~~~~~~~~~~~l~~~li~aiqel~~~i~~l~~~i~~~~~~~~~l~~~~~~~  371 (378)
                      .++..++|.....    ..++-..+.-..++=|+.|.++++.|+.+++++.++.+.|+..++.|
T Consensus        26 ~~Lr~llP~~~~~----~k~sK~~iL~~A~~yI~~L~~~~~~l~~~~~~l~~~~~~L~~~l~~L   85 (88)
T d1nkpa_          26 FALRDQIPELENN----EKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL   85 (88)
T ss_dssp             HHHHTTCGGGTTC----TTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCC----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999867998787----76679999999999999999999999999999999999999999975



>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 378 hypothetical protein CLIBASIA_05160 [Candidatus Li
3gud_A_129 (A:) NECK appendage protein; 3-helix bundle, chape 4e-05
3gw6_A_109-200_241-275127 (A:109-200,A:241-275) Endo-N-acetylneuraminidase; 1e-04
>3gud_A (A:) NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1}Length = 129 Back     alignment and structure
 Score = 43.5 bits (102), Expect = 4e-05
 Identities = 17/128 (13%), Positives = 32/128 (25%), Gaps = 32/128 (25%)

Query: 260 SDERLKKVHGESSASAREIIEQLKFIDFNYLPESGMDSEL-RYLIGFSENNLKEINEVFV 318
           SDER K      S    +  E++KF  + +        E  RY  G     + ++ E   
Sbjct: 1   SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEG 60

Query: 319 DTIGGY-------------------------------LAPNPSVIIPHLAKAIQELLQEV 347
            +   Y                                +  P+         ++  L+ +
Sbjct: 61  LSAFDYGLVGYDEWEATEDEYDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERL 120

Query: 348 KELRDMID 355
                   
Sbjct: 121 SLEHHHHH 128


>3gw6_A (A:109-200,A:241-275) Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F}Length = 127 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target378 hypothetical protein CLIBASIA_05160 [Candidatus Liberib
3gud_A_129 NECK appendage protein; 3-helix bundle, chaperon, 99.69
3gw6_A_109-200_241-275127 Endo-N-acetylneuraminidase; chaperone, glycosidase 99.44
>3gud_A (A:) NECK appendage protein; 3-helix bundle, chaperon, chaperone; HET: PEG; 2.20A {Bacillus phage ga-1} Back     alignment and structure
Probab=99.69  E-value=6.9e-18  Score=156.89  Aligned_cols=96  Identities=18%  Similarity=0.167  Sum_probs=83.0

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHCCEEEEECCCCC-CCCCCCEEEEEEHHHHHHHHHHHEEC------------------
Q ss_conf             03776642111452077898620725888535457-78543402325578887663344106------------------
Q gi|254781130|r  260 SDERLKKVHGESSASAREIIEQLKFIDFNYLPESG-MDSELRYLIGFSENNLKEINEVFVDT------------------  320 (378)
Q Consensus       260 SD~rlK~~i~~~~~~~l~~i~~l~~~~~~~~~~~~-~~~~~~~~~G~iAqev~~v~p~~v~~------------------  320 (378)
                      ||+|||+||.++...+|++|++|+|++|.||.+.. ..+..+.++|||||||++++|++|..                  
T Consensus         1 SD~RlK~~I~~i~~~~L~~i~~l~~~~y~~k~~~~~~~~~~~~~~G~IAQe~~~i~p~~v~~~~d~~~~~~~~~~~~~~~   80 (129)
T 3gud_A            1 SDERHKTDIAPISDKVLDAWEKVKFYQYKFKDAVDEKGEEARYHFGVIAQQIVKVFEDEGLSAFDYGLVGYDEWEATEDE   80 (129)
T ss_dssp             --CCCCCSCCSCCHHHHHHHTTCCCEEECCHHHHHHHGGGSCCEEECCHHHHHHHHHHTTCCGGGGTSEEEEECCCCCCE
T ss_pred             CCHHHCCCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEECCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             96513479833985899999708968988634433467787513141689998741203777443014750455556664


Q ss_pred             -------------CCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -------------76603136777599999999999999999999999
Q gi|254781130|r  321 -------------IGGYLAPNPSVIIPHLAKAIQELLQEVKELRDMID  355 (378)
Q Consensus       321 -------------~~~~~~~~~~~l~~~li~aiqel~~~i~~l~~~i~  355 (378)
                                   ..+.++++|+.|+++|+++||||.++|++|+++|+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~v~~~~l~~~l~~~i~~l~~~i~~Le~~l~  128 (129)
T 3gud_A           81 YDSEGNLVEKGREAGNIYSIRPTECQWLEMACMRRKLERLSLEHHHHH  128 (129)
T ss_dssp             ECSSSCEEECCCCCCEEEEECHHHHHHHHHHHHHHHHHTTC-------
T ss_pred             CCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             366676145673020032073999999999999999999986432357



>3gw6_A (A:109-200,A:241-275) Endo-N-acetylneuraminidase; chaperone, glycosidase, hydrolase; HET: TAM; 2.60A {Enterobacteria phage K1F} Back     alignment and structure