254781135

254781135

hypothetical protein CLIBASIA_05185

GeneID in NCBI database:8210160Locus tag:CLIBASIA_05185
Protein GI in NCBI database:254781135Protein Accession:YP_003065548.1
Gene range:-(1136811, 1137062)Protein Length:83aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80---
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
cccccEEEEEEcccccEEEEEEcccccEEEEccccccccEEEEEEEcccccccEEEEEEEEEEccEEEEEcccccEEEEEEEc
cccccEEEEEEcccccEEEEEEcccccHEEEccccccccccHEEEccccccccEEEEEcHEEcccEEEEEcccccHHHHHccc
mksgewvtfqyttpdktFLIALNgqderqiyngnnckssllpiicaghnqnnpvyfsygwffknrqwyiasdsmDAWTCQLKL
mksgewvtfqyttpdKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
****EWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
***GEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL
MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGWFFKNRQWYIASDSMDAWTCQLKL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target83 hypothetical protein CLIBASIA_05185 [Candidatus Liberib
315122528 532 hypothetical protein CKC_03900 [Candidatus Liberibacter 1 1e-29
227822437 536 hypothetical protein NGR_c18920 [Sinorhizobium fredii N 1 1e-06
150397022 538 hypothetical protein Smed_1819 [Sinorhizobium medicae W 1 2e-06
316933870 558 hypothetical protein Rpdx1_2528 [Rhodopseudomonas palus 2 1e-09
13470677 528 hypothetical protein mll0452 [Mesorhizobium loti MAFF30 2 4e-08
254720058 481 hypothetical protein Bru83_11056 [Brucella sp. 83/13] L 2 6e-06
306839390 481 Hypothetical protein BROD_2246 [Brucella sp. NF 2653] L 2 1e-05
152982947 519 hypothetical protein mma_2198 [Janthinobacterium sp. Ma 2 4e-05
>gi|315122528|ref|YP_004063017.1| hypothetical protein CKC_03900 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 532 Back     alignment and organism information
 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 69/82 (84%)

Query: 1   MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGW 60
           M+SG+W TF YTTP+KTFLIALNGQDERQIY+GN+ KS   PI+C GH+  NP+YFSYGW
Sbjct: 117 MQSGDWSTFHYTTPEKTFLIALNGQDERQIYDGNDWKSDYPPIVCEGHSDINPIYFSYGW 176

Query: 61  FFKNRQWYIASDSMDAWTCQLK 82
            FKNRQWYIA+DSMDAW   ++
Sbjct: 177 LFKNRQWYIAADSMDAWYLPVR 198


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822437|ref|YP_002826409.1| hypothetical protein NGR_c18920 [Sinorhizobium fredii NGR234] Length = 536 Back     alignment and organism information
>gi|150397022|ref|YP_001327489.1| hypothetical protein Smed_1819 [Sinorhizobium medicae WSM419] Length = 538 Back     alignment and organism information
>gi|316933870|ref|YP_004108852.1| hypothetical protein Rpdx1_2528 [Rhodopseudomonas palustris DX-1] Length = 558 Back     alignment and organism information
>gi|13470677|ref|NP_102246.1| hypothetical protein mll0452 [Mesorhizobium loti MAFF303099] Length = 528 Back     alignment and organism information
>gi|254720058|ref|ZP_05181869.1| hypothetical protein Bru83_11056 [Brucella sp. 83/13] Length = 481 Back     alignment and organism information
>gi|306839390|ref|ZP_07472204.1| Hypothetical protein BROD_2246 [Brucella sp. NF 2653] Length = 481 Back     alignment and organism information
>gi|152982947|ref|YP_001353888.1| hypothetical protein mma_2198 [Janthinobacterium sp. Marseille] Length = 519 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00