254781135
hypothetical protein CLIBASIA_05185
| GeneID in NCBI database: | 8210160 | Locus tag: | CLIBASIA_05185 |
| Protein GI in NCBI database: | 254781135 | Protein Accession: | YP_003065548.1 |
| Gene range: | -(1136811, 1137062) | Protein Length: | 83aa |
| Gene description: | hypothetical protein | ||
| COG prediction: | none | ||
| KEGG prediction: | hypothetical protein | ||
| SEED prediction: | hypothetical protein | ||
| Pathway involved in KEGG: | not defined | ||
| Subsystem involved in SEED: | - none - | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
No hits with e-value below 0.05
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 83 | hypothetical protein CLIBASIA_05185 [Candidatus Liberib | |||
| 315122528 | 532 | hypothetical protein CKC_03900 [Candidatus Liberibacter | 1 | 1e-29 | |
| 227822437 | 536 | hypothetical protein NGR_c18920 [Sinorhizobium fredii N | 1 | 1e-06 | |
| 150397022 | 538 | hypothetical protein Smed_1819 [Sinorhizobium medicae W | 1 | 2e-06 | |
| 316933870 | 558 | hypothetical protein Rpdx1_2528 [Rhodopseudomonas palus | 2 | 1e-09 | |
| 13470677 | 528 | hypothetical protein mll0452 [Mesorhizobium loti MAFF30 | 2 | 4e-08 | |
| 254720058 | 481 | hypothetical protein Bru83_11056 [Brucella sp. 83/13] L | 2 | 6e-06 | |
| 306839390 | 481 | Hypothetical protein BROD_2246 [Brucella sp. NF 2653] L | 2 | 1e-05 | |
| 152982947 | 519 | hypothetical protein mma_2198 [Janthinobacterium sp. Ma | 2 | 4e-05 |
| >gi|315122528|ref|YP_004063017.1| hypothetical protein CKC_03900 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 532 | Back alignment and organism information |
|---|
Score = 132 bits (333), Expect = 1e-29, Method: Compositional matrix adjust.
Identities = 58/82 (70%), Positives = 69/82 (84%)
Query: 1 MKSGEWVTFQYTTPDKTFLIALNGQDERQIYNGNNCKSSLLPIICAGHNQNNPVYFSYGW 60
M+SG+W TF YTTP+KTFLIALNGQDERQIY+GN+ KS PI+C GH+ NP+YFSYGW
Sbjct: 117 MQSGDWSTFHYTTPEKTFLIALNGQDERQIYDGNDWKSDYPPIVCEGHSDINPIYFSYGW 176
Query: 61 FFKNRQWYIASDSMDAWTCQLK 82
FKNRQWYIA+DSMDAW ++
Sbjct: 177 LFKNRQWYIAADSMDAWYLPVR 198
|
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|227822437|ref|YP_002826409.1| hypothetical protein NGR_c18920 [Sinorhizobium fredii NGR234] Length = 536 | Back alignment and organism information |
|---|
| >gi|150397022|ref|YP_001327489.1| hypothetical protein Smed_1819 [Sinorhizobium medicae WSM419] Length = 538 | Back alignment and organism information |
|---|
| >gi|316933870|ref|YP_004108852.1| hypothetical protein Rpdx1_2528 [Rhodopseudomonas palustris DX-1] Length = 558 | Back alignment and organism information |
|---|
| >gi|13470677|ref|NP_102246.1| hypothetical protein mll0452 [Mesorhizobium loti MAFF303099] Length = 528 | Back alignment and organism information |
|---|
| >gi|254720058|ref|ZP_05181869.1| hypothetical protein Bru83_11056 [Brucella sp. 83/13] Length = 481 | Back alignment and organism information |
|---|
| >gi|306839390|ref|ZP_07472204.1| Hypothetical protein BROD_2246 [Brucella sp. NF 2653] Length = 481 | Back alignment and organism information |
|---|
| >gi|152982947|ref|YP_001353888.1| hypothetical protein mma_2198 [Janthinobacterium sp. Marseille] Length = 519 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLAST against CDD database part II
No hit with e-value below 0.005
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
No hit with probability above 90.00
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 90.00
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
No hit with probability higher than 90.00