254781136

254781136

hypothetical protein CLIBASIA_05190

GeneID in NCBI database:8210161Locus tag:CLIBASIA_05190
Protein GI in NCBI database:254781136Protein Accession:YP_003065549.1
Gene range:-(1137059, 1137403)Protein Length:114aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE
ccHHHHHHccccccccccEEccccccEEEEcccHHHHHHHHHHHHHHHcccccccEEccccEEEEEEEccccEEEEEEEcccccEEEEEEcccEEEEEcccccccccEEEEEcc
ccHHHHHccccccccccEEEEcccccEEEcccHHHHHHHHHHHHHHccccccccccccccccEEEEccccccHEEEEEEcccccHHEEEHcccEHEEccccccccccEEEEEcc
msqflrnqyfdsnnlsgeyisskdqnflyfptekQQLQENAFSILHnfwpttkgpimrggcrkictldsnssiISAFSYRSSTQQRVFLANHReiydvtdassmqsatvcvcre
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIydvtdassmqsatvcvcre
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDsnssiisafsyrssTQQRVFLANHREIYDVTDASSMQSATVCVCRE
*******QYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE
*SQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSAT*C*CR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE
MSQFLRNQYFDSNNLSGEYISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIMRGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCVCRE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target114 hypothetical protein CLIBASIA_05190 [Candidatus Liberib
315122528 532 hypothetical protein CKC_03900 [Candidatus Liberibacter 1 1e-30
150397022 538 hypothetical protein Smed_1819 [Sinorhizobium medicae W 2 0.002
>gi|315122528|ref|YP_004063017.1| hypothetical protein CKC_03900 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 532 Back     alignment and organism information
 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (73%), Gaps = 3/114 (2%)

Query: 1   MSQFLRNQYFDSNNLSGE---YISSKDQNFLYFPTEKQQLQENAFSILHNFWPTTKGPIM 57
           MS  ++N+Y +  N+  E   + S +  NFL+FP   QQL++N   +L NFWPT+ GP +
Sbjct: 1   MSYLMKNRYHNQKNIGTEQSSFFSREQHNFLHFPVGTQQLEDNISCVLRNFWPTSNGPSI 60

Query: 58  RGGCRKICTLDSNSSIISAFSYRSSTQQRVFLANHREIYDVTDASSMQSATVCV 111
           RGGCR+ICTL+  S+IISAFSY SS+QQR+FLANHREIYDVT+AS MQ A  C+
Sbjct: 61  RGGCRRICTLNHRSNIISAFSYCSSSQQRIFLANHREIYDVTNASLMQPAIRCL 114


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397022|ref|YP_001327489.1| hypothetical protein Smed_1819 [Sinorhizobium medicae WSM419] Length = 538 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00