254781137

254781137

hypothetical protein CLIBASIA_05195

GeneID in NCBI database:8210162Locus tag:CLIBASIA_05195
Protein GI in NCBI database:254781137Protein Accession:YP_003065550.1
Gene range:-(1137405, 1137992)Protein Length:195aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:conserved hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
ccHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEEEEEEEEccccccEEccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHcccccHHEEccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHEcccccccccccccccccccccEEccccccccccccHHHHHHEEEcccccHHHHcccEEEEEcccccEEEEEEccEEEcccccccEEEEccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEikidhwpfhlpqdyyrpllGGAMVMLDLslarpvinavDWGIVKrishtpwywidgrmihlsinspatfryfsknwiidsnkeakhhitadddstllpTYLLIKDIIWRWRRaqglsfddCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHhitadddstllpTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
*NVLA**NTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG
MNVLAILNTVCDLVGLSRFETVYQNQDESTVLLVSFLQQAGEEICLKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHTPWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWRWRRAQGLSFDDCLREFDLALIAEKILWLGG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target195 hypothetical protein CLIBASIA_05195 [Candidatus Liberib
315122529150 hypothetical protein CKC_03905 [Candidatus Liberibacter 1 4e-56
227822438200 hypothetical protein NGR_c18930 [Sinorhizobium fredii N 1 1e-31
150397023200 hypothetical protein Smed_1820 [Sinorhizobium medicae W 1 5e-31
31512253037 hypothetical protein CKC_03910 [Candidatus Liberibacter 1 1e-07
110632594234 hypothetical protein Meso_0233 [Mesorhizobium sp. BNC1] 1 2e-07
117925016233 hypothetical protein Mmc1_1719 [Magnetococcus sp. MC-1] 1 1e-05
218509117232 hypothetical protein RetlB5_17140 [Rhizobium etli Brasi 1 6e-05
327191476234 hypothetical protein RHECNPAF_300006 [Rhizobium etli CN 1 2e-04
13470678233 hypothetical protein mll0453 [Mesorhizobium loti MAFF30 1 5e-04
152983270233 hypothetical protein mma_2199 [Janthinobacterium sp. Ma 1 8e-04
>gi|315122529|ref|YP_004063018.1| hypothetical protein CKC_03905 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 150 Back     alignment and organism information
 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 103/150 (68%), Positives = 125/150 (83%)

Query: 46  LKVDWPQLLQEIKIDHWPFHLPQDYYRPLLGGAMVMLDLSLARPVINAVDWGIVKRISHT 105
           +++DWP+LL+ + I+  PFHLPQD++RPL  GA++M D SLARPVI++VDW IVK+ S  
Sbjct: 1   MRIDWPELLRTVTINSLPFHLPQDFHRPLPSGAVIMPDHSLARPVIHSVDWEIVKKTSQD 60

Query: 106 PWYWIDGRMIHLSINSPATFRYFSKNWIIDSNKEAKHHITADDDSTLLPTYLLIKDIIWR 165
           PWYWID R++HLS + PATFRYFSKNW+I S +  K  ITADDDST+ P YLLIKDIIWR
Sbjct: 61  PWYWIDNRILHLSPSPPATFRYFSKNWVIGSQQNPKQIITADDDSTIFPRYLLIKDIIWR 120

Query: 166 WRRAQGLSFDDCLREFDLALIAEKILWLGG 195
           WRRAQGLSFDD LREFD A+IAEKIL+LGG
Sbjct: 121 WRRAQGLSFDDYLREFDSAVIAEKILFLGG 150


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822438|ref|YP_002826410.1| hypothetical protein NGR_c18930 [Sinorhizobium fredii NGR234] Length = 200 Back     alignment and organism information
>gi|150397023|ref|YP_001327490.1| hypothetical protein Smed_1820 [Sinorhizobium medicae WSM419] Length = 200 Back     alignment and organism information
>gi|315122530|ref|YP_004063019.1| hypothetical protein CKC_03910 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 37 Back     alignment and organism information
>gi|110632594|ref|YP_672802.1| hypothetical protein Meso_0233 [Mesorhizobium sp. BNC1] Length = 234 Back     alignment and organism information
>gi|117925016|ref|YP_865633.1| hypothetical protein Mmc1_1719 [Magnetococcus sp. MC-1] Length = 233 Back     alignment and organism information
>gi|218509117|ref|ZP_03506995.1| hypothetical protein RetlB5_17140 [Rhizobium etli Brasil 5] Length = 232 Back     alignment and organism information
>gi|327191476|gb|EGE58496.1| hypothetical protein RHECNPAF_300006 [Rhizobium etli CNPAF512] Length = 234 Back     alignment and organism information
>gi|13470678|ref|NP_102247.1| hypothetical protein mll0453 [Mesorhizobium loti MAFF303099] Length = 233 Back     alignment and organism information
>gi|152983270|ref|YP_001353889.1| hypothetical protein mma_2199 [Janthinobacterium sp. Marseille] Length = 233 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 195 hypothetical protein CLIBASIA_05195 [Candidatus Liberib
PHA00662215 hypothetical protein 94.84
>PHA00662 hypothetical protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00