254781144

254781144

hypothetical protein CLIBASIA_05240

GeneID in NCBI database:8210169Locus tag:CLIBASIA_05240
Protein GI in NCBI database:254781144Protein Accession:YP_003065557.1
Gene range:-(1141360, 1141590)Protein Length:76aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:putative portal protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70------
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN
ccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcc
cccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccHHHcccccccccc
mdakvniglgsgnrekDIMMVSHLLALQKEILAtfglnnpfvstTHLYNGIARLAEAVgvqnvneyfnnpdseqwn
mdakvniglgsgnrekDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEyfnnpdseqwn
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN
**AKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFN********
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN
*DAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN
MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGVQNVNEYFNNPDSEQWN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target76 hypothetical protein CLIBASIA_05240 [Candidatus Liberib
315122535637 hypothetical protein CKC_03935 [Candidatus Liberibacter 1 1e-29
227822445361 hypothetical protein NGR_c19000 [Sinorhizobium fredii N 1 9e-15
227822448684 hypothetical protein NGR_c19030 [Sinorhizobium fredii N 1 2e-14
150397041683 hypothetical protein Smed_1838 [Sinorhizobium medicae W 1 2e-14
291334599 741 hypothetical protein Daci_1943 [uncultured phage MedDCM 1 0.001
160897386 763 hypothetical protein Daci_1943 [Delftia acidovorans SPH 2 4e-05
148257059 557 hypothetical protein BBta_5791 [Bradyrhizobium sp. BTAi 2 1e-04
260753098 729 hypothetical protein Za10_0861 [Zymomonas mobilis subsp 2 2e-04
241760934 729 hypothetical protein ZmobDRAFT_0099 [Zymomonas mobilis 2 2e-04
56551276 729 hypothetical protein ZMO0380 [Zymomonas mobilis subsp. 2 2e-04
>gi|315122535|ref|YP_004063024.1| hypothetical protein CKC_03935 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 637 Back     alignment and organism information
 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 60/71 (84%), Positives = 67/71 (94%)

Query: 1   MDAKVNIGLGSGNREKDIMMVSHLLALQKEILATFGLNNPFVSTTHLYNGIARLAEAVGV 60
           MDAKVNIGLGSG+REKD MM+SHLL LQKEILATFG+NNPFVS+T+LYNGIARLAE++GV
Sbjct: 503 MDAKVNIGLGSGSREKDTMMISHLLGLQKEILATFGINNPFVSSTNLYNGIARLAESIGV 562

Query: 61  QNVNEYFNNPD 71
           QNVNEYF  PD
Sbjct: 563 QNVNEYFTRPD 573


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227822445|ref|YP_002826417.1| hypothetical protein NGR_c19000 [Sinorhizobium fredii NGR234] Length = 361 Back     alignment and organism information
>gi|227822448|ref|YP_002826420.1| hypothetical protein NGR_c19030 [Sinorhizobium fredii NGR234] Length = 684 Back     alignment and organism information
>gi|150397041|ref|YP_001327508.1| hypothetical protein Smed_1838 [Sinorhizobium medicae WSM419] Length = 683 Back     alignment and organism information
>gi|291334599|gb|ADD94249.1| hypothetical protein Daci_1943 [uncultured phage MedDCM-OCT-S04-C136] Length = 741 Back     alignment and organism information
>gi|160897386|ref|YP_001562968.1| hypothetical protein Daci_1943 [Delftia acidovorans SPH-1] Length = 763 Back     alignment and organism information
>gi|148257059|ref|YP_001241644.1| hypothetical protein BBta_5791 [Bradyrhizobium sp. BTAi1] Length = 557 Back     alignment and organism information
>gi|260753098|ref|YP_003225991.1| hypothetical protein Za10_0861 [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 729 Back     alignment and organism information
>gi|241760934|ref|ZP_04759023.1| hypothetical protein ZmobDRAFT_0099 [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 729 Back     alignment and organism information
>gi|56551276|ref|YP_162115.1| hypothetical protein ZMO0380 [Zymomonas mobilis subsp. mobilis ZM4] Length = 729 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00