254781145

254781145

hypothetical protein CLIBASIA_05245

GeneID in NCBI database:8210170Locus tag:CLIBASIA_05245
Protein GI in NCBI database:254781145Protein Accession:YP_003065558.1
Gene range:-(1141600, 1142652)Protein Length:350aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:putative portal protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY
ccHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHEEEEcccccEEEEEccHHHEEEcccccccccccccccEEEEEHHHHHHccccHHHccccccccccccccccccccccccHHHHHHHEEEEEEEEEEEcccHHHHHHHHHHccccccccEEEcccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHccccccccEEEEccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccc
cHHHHHHHHHHccccEEEEEEcccccccEEEEEEEHHHHHHccEEEEccccccHcEEcccccccccccEEEEEEEccHHHHHHccccHHHHHcccEEEccccccccccccccccHHHHHHHHHHHHEEEEEccccHHHHHHHHHHcccccccEEEEcccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEcHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccEEEEcccc
MALNYFIHMLIKdsdvevlehshredggekvhDLRIRRKysqgkvcvdavspdeflihpdsvdiekspivgrklYLTRSDlismgydresinnlpiissqnientwkfpknqysdKALEMIEYYELYVTIDYDGDGIAELRRVIMAggtgkdnilcneewnelpftclramraphcfigESLAASIIEIQKIKTVLLRQTLDnlywqnqpqtivqegsiidpesvlnpqfgkpirvaagmdirsvlgihsvpmiEKSFSMLHYLDQElvdrtgisdissgfspEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDqwvsfdpry
MALNYFIHMLIKDSDVEVLEHShredggekvhdlrIRRKYSqgkvcvdavspdeflihpdsvdiekspivgrKLYLTRSDLISMGYDRESINNLpiissqnientwkFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIqhqdkvrmvrlrdqwvsfdpry
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY
**LNYFIHMLIKDSDVEVLEHSHR*DGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINN*************************EMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIR*V*******MIEKSFSMLH*********************************************IVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFD***
MALNYFIHMLIKDSDVEV*************HDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY
MALNYFIHMLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSPIVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYVTIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target350 hypothetical protein CLIBASIA_05245 [Candidatus Liberib
315122535 637 hypothetical protein CKC_03935 [Candidatus Liberibacter 1 1e-173
150397041 683 hypothetical protein Smed_1838 [Sinorhizobium medicae W 1 1e-104
227822448 684 hypothetical protein NGR_c19030 [Sinorhizobium fredii N 1 1e-102
227822445 361 hypothetical protein NGR_c19000 [Sinorhizobium fredii N 1 9e-65
291334599 741 hypothetical protein Daci_1943 [uncultured phage MedDCM 1 1e-42
160897386 763 hypothetical protein Daci_1943 [Delftia acidovorans SPH 1 1e-31
291334641 755 portal protein [uncultured phage MedDCM-OCT-S04-C64] Le 1 2e-31
167600438 706 portal protein [Pseudomonas phage LUZ24] Length = 706 1 6e-30
291334834265 hypothetical protein CLIBASIA_05245 [uncultured phage M 1 9e-28
221199509 807 putative portal protein [Burkholderia multivorans CGD2M 1 1e-27
>gi|315122535|ref|YP_004063024.1| hypothetical protein CKC_03935 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 637 Back     alignment and organism information
 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 294/343 (85%), Positives = 317/343 (92%), Gaps = 1/343 (0%)

Query: 9   MLIKDSDVEVLEHSHREDGGEKVHDLRIRRKYSQGKVCVDAVSPDEFLIHPDSVDIEKSP 68
           +LI D +VEVLEH+ R+D  E +HD+RIRRKYSQGKVCVDAV PDEFLIHPD+ DIEKSP
Sbjct: 156 LLISDPEVEVLEHTQRKDREEIIHDIRIRRKYSQGKVCVDAVPPDEFLIHPDATDIEKSP 215

Query: 69  IVGRKLYLTRSDLISMGYDRESINNLPIISSQNIENTWKFPKNQYSDKALEMIEYYELYV 128
           IVGRKLYLTRSDLISMGYDR+ IN L + SSQ  EN+W+  K  +SD ALEMIEYYELYV
Sbjct: 216 IVGRKLYLTRSDLISMGYDRKYINQLQVASSQGNENSWQLSKYHHSDTALEMIEYYELYV 275

Query: 129 TIDYDGDGIAELRRVIMAGGTGKDNILCNEEWNELPFTCLRAMRAPHCFIGESLAASIIE 188
           T+DYD DGIAELRRV+M GGTGKDNIL NEEW+ELPFTCLRA+RAPHCF+GESLA+SIIE
Sbjct: 276 TLDYDNDGIAELRRVVMVGGTGKDNILVNEEWDELPFTCLRAIRAPHCFVGESLASSIIE 335

Query: 189 IQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIIDPESVLNPQFGKPIRVAAGMDIRSVLGI 248
           IQKIKTVLLRQTLDNLYWQNQPQTIVQEGSI+DPESVLNPQFGKPIRV +GMDIRSVLGI
Sbjct: 336 IQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIVDPESVLNPQFGKPIRVVSGMDIRSVLGI 395

Query: 249 HSVPMI-EKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVEL 307
           HSVPMI +KSFSMLHYLDQELVDRTGISDISSG SPEILQNMTATATSLIEQSGVGQVEL
Sbjct: 396 HSVPMIADKSFSMLHYLDQELVDRTGISDISSGLSPEILQNMTATATSLIEQSGVGQVEL 455

Query: 308 IVRTLAQGLEILFRGLLRLIIQHQDKVRMVRLRDQWVSFDPRY 350
           IVRTLAQGLE LFRGLLRLIIQHQDKVRMVRLRDQW+SFDPR+
Sbjct: 456 IVRTLAQGLERLFRGLLRLIIQHQDKVRMVRLRDQWISFDPRH 498


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150397041|ref|YP_001327508.1| hypothetical protein Smed_1838 [Sinorhizobium medicae WSM419] Length = 683 Back     alignment and organism information
>gi|227822448|ref|YP_002826420.1| hypothetical protein NGR_c19030 [Sinorhizobium fredii NGR234] Length = 684 Back     alignment and organism information
>gi|227822445|ref|YP_002826417.1| hypothetical protein NGR_c19000 [Sinorhizobium fredii NGR234] Length = 361 Back     alignment and organism information
>gi|291334599|gb|ADD94249.1| hypothetical protein Daci_1943 [uncultured phage MedDCM-OCT-S04-C136] Length = 741 Back     alignment and organism information
>gi|160897386|ref|YP_001562968.1| hypothetical protein Daci_1943 [Delftia acidovorans SPH-1] Length = 763 Back     alignment and organism information
>gi|291334641|gb|ADD94289.1| portal protein [uncultured phage MedDCM-OCT-S04-C64] Length = 755 Back     alignment and organism information
>gi|167600438|ref|YP_001671938.1| portal protein [Pseudomonas phage LUZ24] Length = 706 Back     alignment and organism information
>gi|291334834|gb|ADD94474.1| hypothetical protein CLIBASIA_05245 [uncultured phage MedDCM-OCT-S06-C1041] Length = 265 Back     alignment and organism information
>gi|221199509|ref|ZP_03572553.1| putative portal protein [Burkholderia multivorans CGD2M] Length = 807 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 350 hypothetical protein CLIBASIA_05245 [Candidatus Liberib
pfam12236480 Head-tail_con Bacteriophage head to tail connecting pro 99.78
PHA00670 540 hypothetical protein 99.64
pfam05126473 consensus 97.54
pfam05133435 Phage_prot_Gp6 Phage portal protein, SPP1 Gp6-like. Thi 98.78
pfam07360412 consensus 97.76
>pfam12236 Head-tail_con Bacteriophage head to tail connecting protein Back     alignment and domain information
>PHA00670 hypothetical protein Back     alignment and domain information
>pfam05126 consensus Back     alignment and domain information
>pfam05133 Phage_prot_Gp6 Phage portal protein, SPP1 Gp6-like Back     alignment and domain information
>pfam07360 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target350 hypothetical protein CLIBASIA_05245 [Candidatus Liberib
2jes_A503 Portal protein; DNA translocation, molecular motor, vir 98.64
>2jes_A Portal protein; DNA translocation, molecular motor, viral portal protein, viral protein; 3.4A {Bacteriophage SPP1} Back     alignment and structure
Probab=98.64  E-value=4e-06  Score=58.31  Aligned_cols=164  Identities=13%  Similarity=0.071  Sum_probs=118.4

Q ss_pred             CCCCCCCCEEEEEEEECCCCEECCCHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCC-CCCCCCCCCCCEEE
Q ss_conf             46555685689856306873203543543102899998998848878763036622531343121-00001122574145
Q gi|254781145|r  157 NEEWNELPFTCLRAMRAPHCFIGESLAASIIEIQKIKTVLLRQTLDNLYWQNQPQTIVQEGSIID-PESVLNPQFGKPIR  235 (350)
Q Consensus       157 ~~~~~~~Pf~~~~~~p~p~~~~G~g~~d~l~~lQ~~~n~~~R~~lDn~~l~~~p~~~v~~~~~~~-~~d~~~~~~g~~v~  235 (350)
                      ..++..+||+.|..     .-+|.|..+.+.+++++.+.++..+.+.+....+|.+.+......+ .+...+.+.++.+.
T Consensus       236 ~~~~~~vPii~~~n-----n~~g~sd~e~v~~LiDa~d~~~S~~~n~~~~~~~~ilv~~g~~~~~~~~~~~~~~~~~~~~  310 (503)
T 2jes_A          236 AIGWGRVPIIPFKN-----NEEMVSDLKFYKDLIDNYDSITSSTMDSFSDFQQIVYVLKNYDGENPKEFTANLRYHSVIK  310 (503)
T ss_dssp             ---CCSCSCEEEES-----SSSCCCGGGGTHHHHHHHHHHHHHHHHHHHHTTSCEEEEEEESCSCHHHHHHHHHHSSEEE
T ss_pred             CCCCCCCCEEEEEC-----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             13468756699746-----8778660652299999999987078899998761464304777766065777766324413


Q ss_pred             ECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             04666554444445688765679999999999988752466643035443355138999999999998899999999999
Q gi|254781145|r  236 VAAGMDIRSVLGIHSVPMIEKSFSMLHYLDQELVDRTGISDISSGFSPEILQNMTATATSLIEQSGVGQVELIVRTLAQG  315 (350)
Q Consensus       236 ~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~~e~~tGi~~~~~G~~~~~~~~~TAt~is~~~~~a~~r~~~~~R~~ae~  315 (350)
                      +..++.++   .+............++.+...+-..+++++.+.+..   .++.++.++..+.....++.....|.|..+
T Consensus       311 ~~~~~~~~---~l~~~~~~~~~~~~~~~L~~~I~~~s~~p~~~~~~~---~gn~Sg~Aik~~~~~l~~ka~~~e~~~~~~  384 (503)
T 2jes_A          311 VSGDGGVD---TLRAEIPVDSAAKELERIQDELYKSAQAVDNSPETI---GGGATGPALEKLYALLDLKANMAERKIRAG  384 (503)
T ss_dssp             EEEEEEEE---EECCCCCHHHHHHHHHHHHHHHHHHTTCCCCSCCSS---TTTTSHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCE---EEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCC---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             58999805---886158848999999999999999839997785334---677439999998747999999999999999


Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             9999999999998748
Q gi|254781145|r  316 LEILFRGLLRLIIQHQ  331 (350)
Q Consensus       316 ~k~l~~~i~~l~~~~~  331 (350)
                      ++.+++.+.+++....
T Consensus       385 l~~~~~li~~~l~~~~  400 (503)
T 2jes_A          385 LRLFFWFFAEYLRNTG  400 (503)
T ss_dssp             HHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999997416




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00