peg_1078

peg_1078

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1142729, 1142917)Protein Length:62aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:PROBABLE DNA PACKAGING PROTEIN GP2
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
ccHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHccccccccccccccccc
cccHEccHHHHHHHHHHccccccEEEcccHHHHHHHHHHHHHHHHccccccccccccccccc
LESILECQEWLDEFHQYhrcegrvikekDDLICASRYALMMKIFSiskpgysswkytprkvi
LESILECQEWLDEFHQyhrcegrvikekDDLICASRYALMMKIfsiskpgysswkytprkvi
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
**SILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
*ESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI
LESILECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target62
315122536455 DNA packaging protein Gp2 [Candidatus Liberibacter sola 1 3e-20
307315429477 protein of unknown function DUF264 [Sinorhizobium melil 1 2e-13
15965769477 DNA packaging protein GP2 [Sinorhizobium meliloti 1021] 1 2e-13
307318836477 protein of unknown function DUF264 [Sinorhizobium melil 1 2e-13
227822449454 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 8e-13
227821702416 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 2e-12
150397042477 hypothetical protein Smed_1839 [Sinorhizobium medicae W 1 3e-12
158422463251 putative DNA packaging protein GP2 [Azorhizobium caulin 1 1e-06
148557334276 hypothetical protein Swit_4440 [Sphingomonas wittichii 1 9e-06
273810450470 TerL [Xylella phage Xfas53] Length = 470 1 2e-05
>gi|315122536|ref|YP_004063025.1| DNA packaging protein Gp2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 455 Back     alignment and organism information
 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/57 (80%), Positives = 51/57 (89%)

Query: 6   ECQEWLDEFHQYHRCEGRVIKEKDDLICASRYALMMKIFSISKPGYSSWKYTPRKVI 62
           +CQEWLDEF QYHR EGR+IKEK+DLICASRY LMMK FS+S+P  SSWKYTPRKVI
Sbjct: 399 DCQEWLDEFRQYHRREGRIIKEKEDLICASRYGLMMKRFSVSRPVCSSWKYTPRKVI 455


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307315429|ref|ZP_07594994.1| protein of unknown function DUF264 [Sinorhizobium meliloti BL225C] Length = 477 Back     alignment and organism information
>gi|15965769|ref|NP_386122.1| DNA packaging protein GP2 [Sinorhizobium meliloti 1021] Length = 477 Back     alignment and organism information
>gi|307318836|ref|ZP_07598268.1| protein of unknown function DUF264 [Sinorhizobium meliloti AK83] Length = 477 Back     alignment and organism information
>gi|227822449|ref|YP_002826421.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 454 Back     alignment and organism information
>gi|227821702|ref|YP_002825672.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 416 Back     alignment and organism information
>gi|150397042|ref|YP_001327509.1| hypothetical protein Smed_1839 [Sinorhizobium medicae WSM419] Length = 477 Back     alignment and organism information
>gi|158422463|ref|YP_001523755.1| putative DNA packaging protein GP2 [Azorhizobium caulinodans ORS 571] Length = 251 Back     alignment and organism information
>gi|148557334|ref|YP_001264916.1| hypothetical protein Swit_4440 [Sphingomonas wittichii RW1] Length = 276 Back     alignment and organism information
>gi|273810450|ref|YP_003344921.1| TerL [Xylella phage Xfas53] Length = 470 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 62
pfam03237380 Terminase_6 Terminase-like family. This family represen 97.09
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 94.45
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information
>pfam04466 Terminase_3 Phage terminase large subunit Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target62
2wbn_A212 G2P, terminase large subunit; large terminase, nuclease 0.004
>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Length = 212 Back     alignment and structure
 Score = 35.1 bits (80), Expect = 0.004
 Identities = 11/56 (19%), Positives = 17/56 (30%), Gaps = 10/56 (17%)

Query: 6   ECQEWLDEFHQYHRCEGR-------VIKEKDDLICASRYALMMKIFSISKPGYSSW 54
                  EF        +       +  + +  I A+RYA       + K G S W
Sbjct: 159 RTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERD---MKKGGVSLW 211


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target62
2wbn_A212 G2P, terminase large subunit; large terminase, nuclease 97.16
>2wbn_A G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Back     alignment and structure
Probab=97.16  E-value=7.8e-05  Score=47.00  Aligned_cols=37  Identities=24%  Similarity=0.290  Sum_probs=31.5

Q ss_pred             HHHHHHHHHHHHHHHHC-------CCEEECHHHHHHHHHHHHHH
Q ss_conf             52899999999875215-------81601000167899999999
Q 537021.9.peg.1    5 LECQEWLDEFHQYHRCE-------GRVIKEKDDLICASRYALMM   41 (62)
Q Consensus         5 ~~C~~Wf~Efr~YHRkd-------GKIVk~~DDlmsAtRYA~m~   41 (62)
                      -.|.++.+||..|+.+.       .+.++..|+.|+|.|||++.
T Consensus       158 ~~C~~li~El~~Y~~d~dk~g~~~~~p~d~~dH~~DAlRYai~~  201 (212)
T 2wbn_A          158 LRTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFER  201 (212)
T ss_dssp             TTCHHHHHHHHHCCEEECTTCCEEEEECSSSCHHHHHHHHHTGG
T ss_pred             CCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             75899999997287156889986688878876187888860303




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target62
2wbn_A_212 G2P, terminase large subunit; large terminase, nuc 96.21
>2wbn_A (A:) G2P, terminase large subunit; large terminase, nuclease, viral protein, DNA packaging; 1.90A {Bacillus phage SPP1} PDB: 2wc9_A Back     alignment and structure
Probab=96.21  E-value=0.0013  Score=41.19  Aligned_cols=37  Identities=22%  Similarity=0.258  Sum_probs=32.5

Q ss_pred             HHHHHHHHHHHHHHHC-------CCEEECHHHHHHHHHHHHHHH
Q ss_conf             2899999999875215-------816010001678999999999
Q 537021.9.peg.1    6 ECQEWLDEFHQYHRCE-------GRVIKEKDDLICASRYALMMK   42 (62)
Q Consensus         6 ~C~~Wf~Efr~YHRkd-------GKIVk~~DDlmsAtRYA~m~~   42 (62)
                      .|.++.+|+..|.+++       .+.++..|+.++|.||+++..
T Consensus       159 ~C~~~i~el~~y~~~~~~~g~~~~~~~~~~dH~~DA~rY~~~~~  202 (212)
T 2wbn_A          159 RTPNIAREFENIDYQTDKNGDPIPRLEDKDNHTIDATRYAFERD  202 (212)
T ss_dssp             TCHHHHHHHHHCCEEECTTCCEEEEECSSSCHHHHHHHHHTGGG
T ss_pred             CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             68899999982882568999866888788862888889714035