peg_1080

peg_1080

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1143644, 1143976)Protein Length:110aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:PROBABLE DNA PACKAGING PROTEIN GP2
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
cccccHHHHHHHHHHEEEEEccccccHHccEEEcccccccccccHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHcccccHHHEEEEEEEccccEEEEEEEc
cccccccccHHHHHHHHHHHccccccHccccEEcccEEEEEEEEcccccccccEEEEccccccccccccccccHHHHHHHHHcccccccEEEEEEEEcccccEEEEEEEc
MAGNQLGKTLAGAAEAAMHLsgcypswwrgyrflQPIVMVAGSVTYELTRDGIQRlllgepmspdqqgsgmipankvLNMTRrsniagaySTVTVRHLSGRDIGFIIESI
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIagaystvtvrhlsgrdigfiiesi
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
******G*TLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
****QLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI
MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGEPMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSGRDIGFIIESI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target110
315122536 455 DNA packaging protein Gp2 [Candidatus Liberibacter sola 1 2e-41
15965769 477 DNA packaging protein GP2 [Sinorhizobium meliloti 1021] 1 8e-32
307315429 477 protein of unknown function DUF264 [Sinorhizobium melil 1 9e-32
307318836 477 protein of unknown function DUF264 [Sinorhizobium melil 1 1e-31
150397042 477 hypothetical protein Smed_1839 [Sinorhizobium medicae W 1 3e-31
227822449 454 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 4e-31
227821702 416 DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] 1 7e-31
260463788209 conserved hypothetical protein [Mesorhizobium opportuni 1 8e-21
13471714254 hypothetical protein mll1771 [Mesorhizobium loti MAFF30 1 2e-20
148557330225 bacteriophage terminase large (ATPase) subunit-like pro 1 9e-20
>gi|315122536|ref|YP_004063025.1| DNA packaging protein Gp2 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 455 Back     alignment and organism information
 Score =  172 bits (436), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 94/100 (94%)

Query: 1   MAGNQLGKTLAGAAEAAMHLSGCYPSWWRGYRFLQPIVMVAGSVTYELTRDGIQRLLLGE 60
           MAGNQLGKTLAGAAEAA+HL+G YP WW G+RF++PIVMVAGSV+YELTRDGIQRLLLGE
Sbjct: 41  MAGNQLGKTLAGAAEAAIHLTGFYPPWWLGHRFVKPIVMVAGSVSYELTRDGIQRLLLGE 100

Query: 61  PMSPDQQGSGMIPANKVLNMTRRSNIAGAYSTVTVRHLSG 100
           PMS D+QGSGMIPA+ ++NMTRR N+AGAY+TVT++H+SG
Sbjct: 101 PMSLDRQGSGMIPAHTIVNMTRRFNVAGAYTTVTIKHVSG 140


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965769|ref|NP_386122.1| DNA packaging protein GP2 [Sinorhizobium meliloti 1021] Length = 477 Back     alignment and organism information
>gi|307315429|ref|ZP_07594994.1| protein of unknown function DUF264 [Sinorhizobium meliloti BL225C] Length = 477 Back     alignment and organism information
>gi|307318836|ref|ZP_07598268.1| protein of unknown function DUF264 [Sinorhizobium meliloti AK83] Length = 477 Back     alignment and organism information
>gi|150397042|ref|YP_001327509.1| hypothetical protein Smed_1839 [Sinorhizobium medicae WSM419] Length = 477 Back     alignment and organism information
>gi|227822449|ref|YP_002826421.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 454 Back     alignment and organism information
>gi|227821702|ref|YP_002825672.1| DNA packaging protein Gp2 [Sinorhizobium fredii NGR234] Length = 416 Back     alignment and organism information
>gi|260463788|ref|ZP_05811985.1| conserved hypothetical protein [Mesorhizobium opportunistum WSM2075] Length = 209 Back     alignment and organism information
>gi|13471714|ref|NP_103281.1| hypothetical protein mll1771 [Mesorhizobium loti MAFF303099] Length = 254 Back     alignment and organism information
>gi|148557330|ref|YP_001264912.1| bacteriophage terminase large (ATPase) subunit-like protein [Sphingomonas wittichii RW1] Length = 225 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 110
pfam03237 380 Terminase_6 Terminase-like family. This family represen 92.76
>pfam03237 Terminase_6 Terminase-like family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00