254781163

254781163

hypothetical protein CLIBASIA_05350

GeneID in NCBI database:8210188Locus tag:CLIBASIA_05350
Protein GI in NCBI database:254781163Protein Accession:YP_003065576.1
Gene range:-(1159267, 1159911)Protein Length:214aa
Gene description:hypothetical protein
COG prediction:[O] ATP-dependent protease Clp, ATPase subunit
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MQDIEDSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR
cccHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccc
cccHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccc
mqdiedsipkitsstGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFfgekfsydVSIKIVLAINVLLFSFVIALlgnpniemAKDIAQLFTLIDNIENGYGQYLEKISQKnvekdffnskfFTHFKEYIDEVDKILMRYgiegipltdfdhEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR
mqdiedsipkitsstgkcLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNihyakelrndwigsnr
MQDIEDSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWEllcrtflwllclGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR
******S*PKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWI****
MQDIEDSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR
*****DSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIG***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDIEDSIPKITSSTGKCLKFIMRAFGLFDSAEQRKLWSLLRYWSVEFWELLCRTFLWLLCLGFFTLFAYWFFGEKFSYDVSIKIVLAINVLLFSFVIALLGNPNIEMAKDIAQLFTLIDNIENGYGQYLEKISQKNVEKDFFNSKFFTHFKEYIDEVDKILMRYGIEGIPLTDFDHEKIKSYLTHIKIVRDCLKKDNIHYAKELRNDWIGSNR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target214 hypothetical protein CLIBASIA_05350 [Candidatus Liberib
254781075266 hypothetical protein CLIBASIA_04885 [Candidatus Li 4e-05
>gi|254781075|ref|YP_003065488.1| hypothetical protein CLIBASIA_04885 [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Back     alignment
 Score = 39.7 bits (91), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/270 (20%), Positives = 100/270 (37%), Gaps = 73/270 (27%)

Query: 6   DSIPKITSSTGKCLKFIMRAFGLFDSAE----QRKLWSLLRYWSVEFWELLCRTFLWLLC 61
           + I     +T K   F+   F +    E     R++W LLR    +F     RTF    C
Sbjct: 3   ERIANTIVATSKKWSFL---FAILSPTEVYNVHRRIWHLLR---DDFGYFTKRTFF---C 53

Query: 62  LGFFTLFAYWFFG-----------EKFSYDVSIK-----------IVLAINVLLFSFVIA 99
             FF    Y FF            +   Y +S +           I   + +L  S ++ 
Sbjct: 54  FAFFITIIYVFFPIFINFLISYIYKNIGYKISSQYYSLTEYTWHDIETFLALLYMSCILV 113

Query: 100 LLGNPNIEMAKDIAQLFTLIDNIENGYGQYLE--KISQKNVEKDFFNSK-----FFTHFK 152
              +  + M +D  ++  +I +I   + QY E  + +  ++++   N       F +  +
Sbjct: 114 ATDDRKLRMIEDGDRIIEIIQSIRRAFDQYKEEERKALSDIQEQLLNDASKKIVFSSDRE 173

Query: 153 EYI-----------------------------DEVDKILMRYGIEGIP--LTDFDHEKIK 181
           EYI                             DE++ IL RY IE IP  L +   ++  
Sbjct: 174 EYIGLHQKQIDLIHQNIDRHLARMKNQLVAESDELEDILSRYSIESIPLDLPEMSQDEAI 233

Query: 182 SYLTHIKIVRDCLKKDNIHYAKELRNDWIG 211
            Y+ H+ ++   + +  I  ++  R ++IG
Sbjct: 234 KYINHVYLLGKWISRGEIQRSQIARREYIG 263

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00