254781175

254781175

UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

GeneID in NCBI database:8210200Locus tag:CLIBASIA_05410
Protein GI in NCBI database:254781175Protein Accession:YP_003065588.1
Gene range:-(1174092, 1174982)Protein Length:296aa
Gene description:UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
COG prediction:[M] UDP-3-O-acyl-N-acetylglucosamine deacetylase
KEGG prediction:lpxC; UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC:3.5.1.-); K02535 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.-]
SEED prediction:UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.-)
Pathway involved in KEGG:Lipopolysaccharide biosynthesis [PATH:las00540]
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
ccccHHHHHHHHHccEEEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccccEEccHHHEEEEEEEEEEcccccEEEEHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHcccEEccccccEEEEEccEEEEEccEEEEEEEccccEEEEEEEccccccccEEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccccccccccEEEEEcccEEEccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHHcccccEEHHccccc
ccccHHHHHHHHHHHHccccccccccccEEEEEEcccccccEEEEEEcccccccccccccccccccccEHHEccccccEEcHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHcccccccccHHEEEEcccEEEEcccEEEEEEcccccEEEEEEEccccccccccEEEcccHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccEEEEcccccEEccccccccccHHHHHHHHHHHHHHHHHcccEEcEEEEEcccHHHHHHHHHHHHccccHEEEEccccc
memlqigrlqhtiadsititgigihsgkranlklcpapegvgilfkctqsggitdSLSALWSNVLRTTLSttigssscqVRTIEHLMAALYAYGIdnviieidstevpimdgSAKAFVEVIERIGIKTLTAKRRYLRIIKSVritsgeswaefsphcsmRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLensvviseddqvmnhgglrysgeefvrhKTLDAIGDIalagypvigcyrscrgsheiNHMALCTLFADKDSYEIVDDHGA
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSttigssscqVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIgiktltakrryLRIIKsvritsgeswaefspHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGaslensvviseddQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
MEMLQIGRLQHTIADSititgigiHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
********L*HTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDH**
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
*EMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDD***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA
MEMLQIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
315122570300 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 1e-116
325293456318 UDP-3-O-3-hydroxymyristoyl N-acetylglucosamine deacetyl 1 2e-88
159185042318 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 7e-88
227822644317 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 1e-83
209550165318 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 2e-83
15965920322 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 3e-83
307308230317 UDP-3-0-acyl N-acetylglucosamine deacetylase [Sinorhizo 1 3e-83
218679960318 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 5e-83
116253038318 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 5e-83
150397274317 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 1 7e-83
>gi|315122570|ref|YP_004063059.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 300 Back     alignment and organism information
 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 247/290 (85%)

Query: 5   QIGRLQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNV 64
           Q+  LQHTIADSITITGIG+H G+  +LKL PA EGVGILFK  QSG + DS+ A WSNV
Sbjct: 6   QLLELQHTIADSITITGIGVHFGRSISLKLHPATEGVGILFKLVQSGKVCDSVLASWSNV 65

Query: 65  LRTTLSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERI 124
           + T LST +GSSS ++ T EHLMAAL+AYGIDNVIIE+D +EVPIMDGSA AFVE IER+
Sbjct: 66  VGTNLSTILGSSSYKIHTTEHLMAALHAYGIDNVIIEMDESEVPIMDGSALAFVEGIERV 125

Query: 125 GIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQT 184
           GIK L AKRR++RI+K VR+ +G+SWAEF P  + RFEISI+FK+ +IGFQKW G+LT+ 
Sbjct: 126 GIKALQAKRRFMRILKPVRVKNGDSWAEFIPCDTARFEISIQFKSKLIGFQKWEGNLTKQ 185

Query: 185 VFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRH 244
           VFR+EI AARTFGFL+DV++YR+AG ALG+SLENS+VIS DDQ++N  GLRYSGEEFVRH
Sbjct: 186 VFRDEICAARTFGFLQDVDQYRQAGYALGSSLENSIVISADDQIINDEGLRYSGEEFVRH 245

Query: 245 KTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDH 294
           KTLDAIGDIAL+G  +IGCYRS R SH+IN+MALC LFADK++YEIV+D+
Sbjct: 246 KTLDAIGDIALSGNRLIGCYRSHRVSHKINYMALCALFADKNAYEIVEDY 295


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293456|ref|YP_004279320.1| UDP-3-O-3-hydroxymyristoyl N-acetylglucosamine deacetylase [Agrobacterium sp. H13-3] Length = 318 Back     alignment and organism information
>gi|159185042|ref|NP_355050.2| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Agrobacterium tumefaciens str. C58] Length = 318 Back     alignment and organism information
>gi|227822644|ref|YP_002826616.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Sinorhizobium fredii NGR234] Length = 317 Back     alignment and organism information
>gi|209550165|ref|YP_002282082.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 318 Back     alignment and organism information
>gi|15965920|ref|NP_386273.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Sinorhizobium meliloti 1021] Length = 322 Back     alignment and organism information
>gi|307308230|ref|ZP_07587939.1| UDP-3-0-acyl N-acetylglucosamine deacetylase [Sinorhizobium meliloti BL225C] Length = 317 Back     alignment and organism information
>gi|218679960|ref|ZP_03527857.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Rhizobium etli CIAT 894] Length = 318 Back     alignment and organism information
>gi|116253038|ref|YP_768876.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Rhizobium leguminosarum bv. viciae 3841] Length = 318 Back     alignment and organism information
>gi|150397274|ref|YP_001327741.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Sinorhizobium medicae WSM419] Length = 317 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
PRK13186295 PRK13186, lpxC, UDP-3-O-[3-hydroxymyristoyl] N-acetylgl 1e-109
pfam03331276 pfam03331, LpxC, UDP-3-O-acyl N-acetylglycosamine deace 3e-73
TIGR00325297 TIGR00325, lpxC, UDP-3-0-acyl N-acetylglucosamine deace 4e-71
PRK13188 464 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyri 3e-60
PRK13187304 PRK13187, PRK13187, UDP-3-O-[3-hydroxymyristoyl] N-acet 1e-46
COG0774300 COG0774, LpxC, UDP-3-O-acyl-N-acetylglucosamine deacety 1e-91
>gnl|CDD|183882 PRK13186, lpxC, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|146126 pfam03331, LpxC, UDP-3-O-acyl N-acetylglycosamine deacetylase Back     alignment and domain information
>gnl|CDD|129425 TIGR00325, lpxC, UDP-3-0-acyl N-acetylglucosamine deacetylase Back     alignment and domain information
>gnl|CDD|183883 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|171888 PRK13187, PRK13187, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed Back     alignment and domain information
>gnl|CDD|31117 COG0774, LpxC, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
PRK13186299 lpxC UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 100.0
pfam03331276 LpxC UDP-3-O-acyl N-acetylglycosamine deacetylase. The 100.0
COG0774300 LpxC UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell 100.0
PRK13188 465 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylgluco 100.0
PRK13187305 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 100.0
TIGR00325307 lpxC UDP-3-0-acyl N-acetylglucosamine deacetylase; Inte 100.0
cd01684115 Tet_like_IV EF-G_domain IV_RPP domain is a part of bact 93.53
>PRK13186 lpxC UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed Back     alignment and domain information
>pfam03331 LpxC UDP-3-O-acyl N-acetylglycosamine deacetylase Back     alignment and domain information
>COG0774 LpxC UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>PRK13187 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed Back     alignment and domain information
>TIGR00325 lpxC UDP-3-0-acyl N-acetylglucosamine deacetylase; InterPro: IPR004463 UDP-3-O-N-acetylglucosamine deacetylases are zinc-dependent metalloamidases that catalyse the second and committed step in the biosynthesis of lipid A Back     alignment and domain information
>cd01684 Tet_like_IV EF-G_domain IV_RPP domain is a part of bacterial ribosomal protected proteins (RPP) family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
2ves_A299 Crystal Structure Of Lpxc From Pseudomonas Aerugino 3e-82
3p3g_A300 Crystal Structure Of The Escherichia Coli LpxcLPC-0 6e-78
3nzk_A311 Structure Of Lpxc From Yersinia Enterocolitica Comp 1e-77
1xxe_A282 Rdc Refined Solution Structure Of The AalpxcTU-514 3e-54
2jt2_A274 Solution Structure Of The Aquifex Aeolicus Lpxc- Ch 5e-54
1p42_A270 Crystal Structure Of Aquifex Aeolicus Lpxc Deacetyl 5e-54
2j65_A271 Structure Of Lpxc From Aquifex Aeolicus In Complex 7e-54
3p3c_A274 Crystal Structure Of The Aquifex Aeolicus LpxcLPC-0 7e-54
2go3_A267 Crystal Structure Of Aquifex Aeolicus Lpxc Complexe 8e-54
>gi|165761237|pdb|2VES|A Chain A, Crystal Structure Of Lpxc From Pseudomonas Aeruginosa Complexed With The Potent Bb-78485 Inhibitor Length = 299 Back     alignment and structure
 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 116/290 (40%), Positives = 177/290 (61%), Gaps = 5/290 (1%)

Query: 9   LQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTT 68
            Q T+ + I  TG+G+HSG++  L L PAP   GI+F  T    + + + A   NV  TT
Sbjct: 3   KQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFSRTDLDPVVE-IPARAENVGETT 61

Query: 69  LSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKT 128
           +STT+     +V T+EHL++A+   GIDN  +E+ ++EVPIMDGSA  FV +I+  G++ 
Sbjct: 62  MSTTLVKGDVKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQE 121

Query: 129 LTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIG--FQKWAGDLTQTVF 186
             A ++++RI + V +  G+  A F P    +    I+F + +     Q+ + D + T F
Sbjct: 122 QEAAKKFIRIKREVSVEEGDKRAVFVPFDGFKVSFEIDFDHPVFRGRTQQASVDFSSTSF 181

Query: 187 RNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKT 246
             E+  ARTFGF+RD+E  R    ALG S+EN++V+  +++V+N  GLRY  +EFV+HK 
Sbjct: 182 VKEVSRARTFGFMRDIEYLRSQNLALGGSVENAIVVD-ENRVLNEDGLRYE-DEFVKHKI 239

Query: 247 LDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDHGA 296
           LDAIGD+ L G  +IG +R  +  H +N+  L TL ADKD++E+V    A
Sbjct: 240 LDAIGDLYLLGNSLIGEFRGFKSGHALNNQLLRTLIADKDAWEVVTFEDA 289


>gi|316983318|pdb|3P3G|A Chain A, Crystal Structure Of The Escherichia Coli LpxcLPC-009 Complex Length = 300 Back     alignment and structure
gi|316983264|pdb|3NZK|A Chain A, Structure Of Lpxc From Yersinia Enterocolitica Complexed With Chir090 Inhibitor Length = 311 Back     alignment and structure
gi|56967295|pdb|1XXE|A Chain A, Rdc Refined Solution Structure Of The AalpxcTU-514 Complex Length = 282 Back     alignment and structure
>gi|161760904|pdb|2JT2|A Chain A, Solution Structure Of The Aquifex Aeolicus Lpxc- Chir-090 Complex Length = 274 Back     alignment and structure
>gi|33357853|pdb|1P42|A Chain A, Crystal Structure Of Aquifex Aeolicus Lpxc Deacetylase (Zinc-Inhibited Form) Length = 270 Back     alignment and structure
>gi|119390417|pdb|2J65|A Chain A, Structure Of Lpxc From Aquifex Aeolicus In Complex With Udp Length = 271 Back     alignment and structure
>gi|316983316|pdb|3P3C|A Chain A, Crystal Structure Of The Aquifex Aeolicus LpxcLPC-009 Complex Length = 274 Back     alignment and structure
>gi|110590370|pdb|2GO3|A Chain A, Crystal Structure Of Aquifex Aeolicus Lpxc Complexed With Imidazole. Length = 267 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
1p42_A270 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 2e-69
2ves_A299 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 8e-61
>1p42_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus} SCOP: d.14.1.7 d.14.1.7 PDB: 1yh8_A* 1yhc_A* 2j65_A* 2ies_A* 2ier_A* 2o3z_A* 2jt2_A* 1xxe_A* 2go3_A* 2go4_A* Length = 270 Back     alignment and structure
 Score =  257 bits (658), Expect = 2e-69
 Identities = 90/280 (32%), Positives = 138/280 (49%), Gaps = 12/280 (4%)

Query: 9   LQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTT 68
           L+ T+ + ++  G+GIH+G+ + L + P  EG GI F           + A    V+ T 
Sbjct: 2   LEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNG-----VYIPARHEFVVHTN 56

Query: 69  LSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKT 128
            ST +G    +++T+EH+++ L+   I NV IE+   E+PI+DGS   F E I +  I  
Sbjct: 57  HSTDLGFKGQRIKTVEHILSVLHLLEITNVTIEVIGNEIPILDGSGWEFYEAIRKN-ILN 115

Query: 129 LTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRN 188
              +  Y  + + + +       +  P  ++      EFKN  +G QK+           
Sbjct: 116 QNREIDYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKN-FLGRQKFTFVEG---NEE 171

Query: 189 EIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLD 248
           EI  ARTF F  ++E  +K G   G SL+N++V+   D+V N  GLRY   E VRHK  D
Sbjct: 172 EIVLARTFAFDWEIEHIKKVGLGKGGSLKNTLVLG-KDKVYNPEGLRYE-NEPVRHKVFD 229

Query: 249 AIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSY 288
            IGD+ L G PV G + S RG H +N   +  L   +   
Sbjct: 230 LIGDLYLLGSPVKGKFYSFRGGHSLNVKLVKELAKKQKLT 269


>2ves_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa} Length = 299 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
2ves_A299 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 100.0
1p42_A270 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 100.0
>2ves_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=0  Score=778.04  Aligned_cols=283  Identities=41%  Similarity=0.675  Sum_probs=274.6

Q ss_pred             CCHHHCCEEEEEEEEECCCCEEEEEEEECCCCCCEEEEEEECCCCCCEEECCHHHHHHHHHHCCCCCCEEEEEEHHHHHH
Q ss_conf             17110751999999703797789999837888718999805688886263109986663220134763158864899899
Q gi|254781175|r    9 LQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMA   88 (296)
Q Consensus         9 ~Q~Ti~~~v~~~GiGLHsG~~~~i~l~PA~~~~GI~F~R~dl~~~~~~I~A~~~~V~~t~~~T~L~~~~~~V~TVEHLLA   88 (296)
                      +||||+++++|+|+|||||+.|+|+++||++|+||+|+|+|+++ ++.|+|+++||++|.+||+|++++++|+|||||||
T Consensus         3 ~Q~TI~~~i~~~GiGLHsG~~v~v~l~PA~~~tGI~F~R~Dl~~-~~~I~A~~~nV~~t~~~T~l~~~~~~V~TVEHLLA   81 (299)
T 2ves_A            3 KQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFSRTDLDP-VVEIPARAENVGETTMSTTLVKGDVKVDTVEHLLS   81 (299)
T ss_dssp             EEEEESSCEEEEEECTTTCSEEEEEEEECCTTCCEEEEETTSSS-CEEEECCGGGBCCCSSSCCEEETTEEEBCCHHHHH
T ss_pred             CCCCCCCEEEEEEEECCCCCEEEEEEEECCCCCEEEEEEECCCC-CCEECCCHHHCCCCCCEEEEECCCEEEEEHHHHHH
T ss_conf             87347865999999815797889999989999769999946999-82531018871256402575048269973999999


Q ss_pred             HHHHHHHEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCEEEECCCEEEEECCEEEEEECCCCCEEEEEEEEC
Q ss_conf             99872000599996488783005828999998854455444787514770463499817714654147663378999708
Q gi|254781175|r   89 ALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRRYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFK  168 (296)
Q Consensus        89 AL~glgIDN~~Ieidg~EiPIlDGSA~~fv~~i~~aGi~eq~~~r~~~~i~~~v~v~~~~~~i~~~P~~~l~i~~~idf~  168 (296)
                      ||+|||||||+||+||+|+|||||||.+||++|++||+++|+++|++++|++||+|+++++++.+.|+++++++|+|+|+
T Consensus        82 AL~glgIDN~~Ievdg~EvPIlDGSA~~fv~~i~~aGi~eq~~~r~~~~I~~~V~v~~~~~~i~~~P~~~~~i~~~i~f~  161 (299)
T 2ves_A           82 AMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQEQEAAKKFIRIKREVSVEEGDKRAVFVPFDGFKVSFEIDFD  161 (299)
T ss_dssp             HHHHHTCCCEEEEESSSBCCCTTSSSHHHHHHHHHHCEEEEEEECCEEEECSCEEEEETTEEEEEECCSSEEEEEECCCC
T ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEEEEEEEEEECCCEEEECCCCCCEEEEEEECC
T ss_conf             99867951499997998678889666999999986388103675327998668999976818997578885579999747


Q ss_pred             CCCCCC--CCCCCCCCHHHHHHHHCCCCEEEEEHHHHHHHHCCCCCCCCCCCCEEEECCCCEECCCCCCCCCCCCCHHHH
Q ss_conf             843130--002345545778985146503222025788864200032133464564137733106774789972001148
Q gi|254781175|r  169 NSIIGF--QKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALGASLENSVVISEDDQVMNHGGLRYSGEEFVRHKT  246 (296)
Q Consensus       169 ~~~Ig~--Q~~~~~~~~~~f~~eIa~ARTF~~~~eie~L~~~Gl~~Ggsl~NaiVi~~~~~i~n~~~LR~~~dE~vRHKi  246 (296)
                      +|.||.  |++++++++++|.+||||||||||++|+|+|+++||+|||||+||+|++ +++|+|++||||+ |||||||+
T Consensus       162 ~~~i~~~~q~~~~~~~~~~f~~eia~ARTF~f~~~ve~L~~~Gl~~Ggsl~NaiV~~-~~~vlN~~gLR~~-dE~vRHKi  239 (299)
T 2ves_A          162 HPVFRGRTQQASVDFSSTSFVKEVSRARTFGFMRDIEYLRSQNLALGGSVENAIVVD-ENRVLNEDGLRYE-DEFVKHKI  239 (299)
T ss_dssp             STTTTTSCCEEEEETTTCCHHHHTTTCCCEEEHHHHHHHHHTTCSTTCSTTSSEEEC-SSSBCSTTCCSST-THHHHHHH
T ss_pred             CCCCCCCCEEEEEECCCCHHHHHHHCCCCEEEHHHHHHHHHCCCCCCCCCCCEEEEC-CCCCCCCCCCCCC-CCCHHHHH
T ss_conf             743356512999963862178886566625629999999972851343545469983-8944379887774-70133455


Q ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHCCCCCCEEEECC
Q ss_conf             999898997599646899997788089999999998096671566207
Q gi|254781175|r  247 LDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKDSYEIVDDH  294 (296)
Q Consensus       247 LDlIGDL~L~G~pi~g~i~a~k~GH~ln~~l~~~l~~~~~~~~~v~~~  294 (296)
                      |||||||||+|+|++|||+|+|+||++|++|+++|+++++|||+++.+
T Consensus       240 LDliGDL~L~G~~i~G~i~a~k~GH~ln~~l~~~L~~~~~~~~~~~~~  287 (299)
T 2ves_A          240 LDAIGDLYLLGNSLIGEFRGFKSGHALNNQLLRTLIADKDAWEVVTFE  287 (299)
T ss_dssp             HHHHHHHGGGSSEEEEEEEEESCCHHHHHHHHHHHHHCGGGEEEECCS
T ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             677678986489528999998788589999999997195651688535



>1p42_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus} SCOP: d.14.1.7 d.14.1.7 PDB: 1yh8_A* 1yhc_A* 2j65_A* 2ies_A* 2ier_A* 2o3z_A* 2jt2_A* 1xxe_A* 2go3_A* 2go4_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
d1p42a1120 d.14.1.7 (A:2-127) UDP-3-O-[3-hydroxymyristoyl] N-acety 2e-28
d1p42a2147 d.14.1.7 (A:128-280) UDP-3-O-[3-hydroxymyristoyl] N-ace 1e-25
>d1p42a1 d.14.1.7 (A:2-127) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} Length = 120 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC
domain: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC
species: Aquifex aeolicus [TaxId: 63363]
 Score =  120 bits (302), Expect = 2e-28
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 5/119 (4%)

Query: 9   LQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTT 68
           L+ T+ + ++  G+GIH+G+ + L + P  EG GI F           + A    V+ T 
Sbjct: 2   LEKTVKEKLSFEGVGIHTGEYSKLIIHPEKEGTGIRFFKNG-----VYIPARHEFVVHTN 56

Query: 69  LSTTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIK 127
            ST +G    +++T+EH+++ L+   I NV IE+   E+PI+DGS   F E I +  + 
Sbjct: 57  HSTDLGFKGQRIKTVEHILSVLHLLEITNVTIEVIGNEIPILDGSGWEFYEAIRKNILN 115


>d1p42a2 d.14.1.7 (A:128-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} Length = 147 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
d1p42a2147 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 100.0
d1p42a1120 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet 100.0
>d1p42a2 d.14.1.7 (A:128-280) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC
domain: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC
species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00  E-value=0  Score=384.17  Aligned_cols=147  Identities=35%  Similarity=0.519  Sum_probs=139.2

Q ss_pred             CEEEECCCEEEEECCEEEEEECCCCCEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEHHHHHHHHCCCCCC
Q ss_conf             14770463499817714654147663378999708843130002345545778985146503222025788864200032
Q gi|254781175|r  134 RYLRIIKSVRITSGESWAEFSPHCSMRFEISIEFKNSIIGFQKWAGDLTQTVFRNEIYAARTFGFLRDVERYRKAGCALG  213 (296)
Q Consensus       134 ~~~~i~~~v~v~~~~~~i~~~P~~~l~i~~~idf~~~~Ig~Q~~~~~~~~~~f~~eIa~ARTF~~~~eie~L~~~Gl~~G  213 (296)
                      .|++|++||+|+++++|+.+.|+++|+|+|+|||++ +||+|++++.   ++|.+||||||||||++|+++|+++||+||
T Consensus         1 ~~~~I~k~I~v~~g~~~i~i~P~~~~~It~~Idf~~-~Ig~Q~~~~~---~~f~~eIa~ARTFgf~~eie~L~~~Gl~~G   76 (147)
T d1p42a2           1 DYFVVEEPIIVEDEGRLIKAEPSDTLEVTYEGEFKN-FLGRQKFTFV---EGNEEEIVLARTFAFDWEIEHIKKVGLGKG   76 (147)
T ss_dssp             CCEECCSCEEEEETTEEEEEECCSSCEEEEEEECSS-TTCEEEEEEE---TTCGGGTTTCCCEEEHHHHHHHHHTTCCTT
T ss_pred             CEEEECEEEEEEECCEEEEEECCCCCEEEEEEECCC-CCCCEEEEEE---CCCHHHHHCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             959987289999899999998589968999997378-7762256760---577888622025479998999865571277


Q ss_pred             CCCCCCEEEECCCCEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHCCCC
Q ss_conf             1334645641377331067747899720011489998989975996468999977880899999999980966
Q gi|254781175|r  214 ASLENSVVISEDDQVMNHGGLRYSGEEFVRHKTLDAIGDIALAGYPVIGCYRSCRGSHEINHMALCTLFADKD  286 (296)
Q Consensus       214 gsl~NaiVi~~~~~i~n~~~LR~~~dE~vRHKiLDlIGDL~L~G~pi~g~i~a~k~GH~ln~~l~~~l~~~~~  286 (296)
                      |||+||+|+++ ++++|++||||+ ||||||||||+||||||+|+|++|||+|+||||.+|++|+++|++++.
T Consensus        77 gsl~naiVi~~-~~~~n~~~LR~~-~E~vRHKiLD~iGDl~L~G~pi~G~i~a~k~GH~ln~~l~~~l~~~~~  147 (147)
T d1p42a2          77 GSLKNTLVLGK-DKVYNPEGLRYE-NEPVRHKVFDLIGDLYLLGSPVKGKFYSFRGGHSLNVKLVKELAKKQK  147 (147)
T ss_dssp             CCTTTCEEECS-SCBCSTTCCSST-THHHHHHHHHHHHHHGGGSSCEECEEEEESCCHHHHHHHHHHHHHTTC
T ss_pred             CCCCCCEEECC-CCEECCCCCCCC-CCCCHHHHHHHCCCHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             36012325346-310024465442-201236665540637555997389999984777999999999985159



>d1p42a1 d.14.1.7 (A:2-127) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d
2ves_A_1-125_182-189_229-248153 (A:1-125,A:182-189,A:229-248) UDP-3-O-[3-hydroxymy 8e-40
1p42_A_1-119119 (A:1-119) UDP-3-O-[3-hydroxymyristoyl] N-acetylglu 7e-37
1p42_A_120-177_217-270112 (A:120-177,A:217-270) UDP-3-O-[3-hydroxymyristoyl] 5e-15
2ves_A_126-181_249-299107 (A:126-181,A:249-299) UDP-3-O-[3-hydroxymyristoyl] 4e-09
1p42_A_178-21639 (A:178-216) UDP-3-O-[3-hydroxymyristoyl] N-acetylg 1e-10
2ves_A_190-22839 (A:190-228) UDP-3-O-[3-hydroxymyristoyl] N-acetylg 1e-10
2ves_A_126-181_249-299107 (A:126-181,A:249-299) UDP-3-O-[3-hydroxymyristoyl] 5e-10
>2ves_A (A:1-125,A:182-189,A:229-248) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa}Length = 153 Back     alignment and structure
 Score =  158 bits (401), Expect = 8e-40
 Identities = 51/123 (41%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 10  QHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTL 69
           Q T+ + I  TG+G+HSG++  L L PAP   GI+F  T    + + + A   NV  TT+
Sbjct: 4   QRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFSRTDLDPVVE-IPARAENVGETTM 62

Query: 70  STTIGSSSCQVRTIEHLMAALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTL 129
           STT+     +V T+EHL++A+   GIDN  +E+ ++EVPIMDGSA  FV +I+  G++  
Sbjct: 63  STTLVKGDVKVDTVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQEQ 122

Query: 130 TAK 132
            A 
Sbjct: 123 EAA 125


>1p42_A (A:1-119) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus}Length = 119 Back     alignment and structure
>1p42_A (A:120-177,A:217-270) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus}Length = 112 Back     alignment and structure
>2ves_A (A:126-181,A:249-299) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa}Length = 107 Back     alignment and structure
>1p42_A (A:178-216) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus}Length = 39 Back     alignment and structure
>2ves_A (A:190-228) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa}Length = 39 Back     alignment and structure
>2ves_A (A:126-181,A:249-299) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa}Length = 107 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target296 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacet
2ves_A_1-125_182-189_229-248153 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 100.0
1p42_A_1-119119 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 100.0
1p42_A_120-177_217-270112 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 99.97
2ves_A_126-181_249-299107 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 99.91
2ves_A_190-22839 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 99.31
1p42_A_178-21639 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine d 99.31
>2ves_A (A:1-125,A:182-189,A:229-248) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=0  Score=388.71  Aligned_cols=125  Identities=41%  Similarity=0.608  Sum_probs=121.2

Q ss_pred             CCHHHCCEEEEEEEEECCCCEEEEEEEECCCCCCEEEEEEECCCCCCEEECCHHHHHHHHHHCCCCCCEEEEEEHHHHHH
Q ss_conf             17110751999999703797789999837888718999805688886263109986663220134763158864899899
Q gi|254781175|r    9 LQHTIADSITITGIGIHSGKRANLKLCPAPEGVGILFKCTQSGGITDSLSALWSNVLRTTLSTTIGSSSCQVRTIEHLMA   88 (296)
Q Consensus         9 ~Q~Ti~~~v~~~GiGLHsG~~~~i~l~PA~~~~GI~F~R~dl~~~~~~I~A~~~~V~~t~~~T~L~~~~~~V~TVEHLLA   88 (296)
                      +|+||+++++|+|+|||||++|+++|+||++|+||+|+|+|+++ .+.|||+++||.+|.|||+|++++.+|+|||||||
T Consensus         3 ~Q~TI~~~v~~~GiGLHSG~~v~v~l~PA~~~tGI~F~R~Dl~~-~~~I~A~~~~V~~t~l~T~L~~~~~~V~TVEHLLA   81 (153)
T 2ves_A            3 KQRTLKNIIRATGVGLHSGEKVYLTLKPAPVDTGIVFSRTDLDP-VVEIPARAENVGETTMSTTLVKGDVKVDTVEHLLS   81 (153)
T ss_dssp             EEEEESSCEEEEEECTTTCSEEEEEEEECCTTCCEEEEETTSSS-CEEEECCGGGBCCCSSSCCEEETTEEEBCCHHHHH
T ss_pred             CCCCCCCEEEEEEEECCCCCEEEEEEEECCCCCEEEEEEECCCC-CCEECCCHHHCCCCCCEEEEEECEEEEEEHHHHHH
T ss_conf             87346862899999835795789999989999869999905999-82303678881466653686413058860788898


Q ss_pred             HHHHHHHEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9987200059999648878300582899999885445544478751
Q gi|254781175|r   89 ALYAYGIDNVIIEIDSTEVPIMDGSAKAFVEVIERIGIKTLTAKRR  134 (296)
Q Consensus        89 AL~glgIDN~~Ieidg~EiPIlDGSA~~fv~~i~~aGi~eq~~~r~  134 (296)
                      ||+|||||||+||+||+|+|||||||++||++|++||+++|+++.+
T Consensus        82 AL~glGIDN~~Ieidg~EiPIlDGSA~~fv~ai~~aGi~eq~~~~~  127 (153)
T 2ves_A           82 AMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQEQEAAVK  127 (153)
T ss_dssp             HHHHHTCCCEEEEESSSBCCCTTSSSHHHHHHHHHHCEEEEEEEHH
T ss_pred             HHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHH
T ss_conf             9874270179999168987453643189999998628731013499



>1p42_A (A:1-119) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1p42_A (A:120-177,A:217-270) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2ves_A (A:126-181,A:249-299) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2ves_A (A:190-228) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; LPXC, hydrolase, BB-78485, antibiotics, lipid synthesis, metalloprotease; HET: GVR; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1p42_A (A:178-216) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; alpha+beta fold, hydrophobic tunnel, hydrolase; HET: MYR; 2.00A {Aquifex aeolicus} Back     alignment and structure