254781176

254781176

cell division protein FtsZ

GeneID in NCBI database:8210201Locus tag:CLIBASIA_05415
Protein GI in NCBI database:254781176Protein Accession:YP_003065589.1
Gene range:-(1175072, 1176580)Protein Length:502aa
Gene description:cell division protein FtsZ
COG prediction:[D] Cell division GTPase
KEGG prediction:ftsZ; cell division protein FtsZ; K03531 cell division protein FtsZ
SEED prediction:Cell division protein FtsZ (EC 3.4.24.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVPESSAPHRLISRQRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH
cccccccccccccccEEEEEEEcccHHHHHHHHHHccccccEEEEEcccHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHHccEEEEEcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccEEEEEEEEEccccHHHHHHHHHHHccccccccHHHccEEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccHHHcccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHccccHHHHHHHcc
cccccccccHHHccccEEEEEEHHHHHHHHHHHHHccccccEEEEEEcEHHHHccccccEEEEccHHHHccEcccccHHHHHHHHHHcHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHcccEEEEEEEEccHHHcHHHHHHHHHHHHHHHccccEEEEEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccEEEEEEEEEEccccHHHHHHHHHHccHHHccccHHHccEEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHccEEEcccccccccccccccccccccHHHHHcccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHcccccccccccHHHccHHHHHHHHcc
mvgknanmditelkpritvfgvgggggnaVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSgiteglgagshpevgRAAAEECIDEITEMLDKTHMCFvtagmgggtgtgaAPIIAKIARnkgvltvgvvtkpfhfegsrrMRVAESGIEALQETVDTLivipnqnlfriandkttfadAFSMADQVLYSGVSCITDlmikeglinldfADVRSVMRNMGRammgtgeasghgrgIQAAEAAVAnplldeasmkgSQGLLISitggsdltlfeVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGienrlhrdgddnrdsslttheslknakflnlsspklpvedshvmhHSVIaenahctdnqedlnnqenslvgdqnqelfleedvvpessaphrlisrqrhsdsveERGVMALIKRIAHSfglheniaseedsvhmksesTVSYlrernpsiseesiddfcvqskptvkceedkleipaflrrqsh
mvgknanmditelkpRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTkpfhfegsrrmRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIreevdseanIILGAtfdealegVIRVSVVAtgienrlhrdgddnrdsslttheslknakflnlSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVpessaphrlisrqrhsdsveeRGVMALIKRIAHSFGLHeniaseedsvhmkSESTVSYLRErnpsiseesiddfcVQSKPtvkceedkleipaflrrqsh
MVGKNANMDITELKPRITVFgvgggggnavnnmvssgLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVtagmgggtgtgaaPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVPESSAPHRLISRQRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH
************LKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATG*******************************************************************************************************************************************************************************PAFLRRQ**
MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGT***********AAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVP******************EERGVMALIKRIAHSFGLHENIASE****************ERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH
*****ANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIEN******************************************************NQEDLNNQENSLVGDQ*Q****E*****************************ALIKRIAHSFGLHENIAS*******************************************DKLEIPAFLRRQS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVPESSAPHRLISRQRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH
MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVPESSAPHRLISRQRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH
MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDGDDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHSVIAENAHCTDNQEDLNNQENSLVGDQNQELFLEEDVVPESSAPHRLISRQRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target502 cell division protein FtsZ [Candidatus Liberibacter asi
315122571509 cell division protein FtsZ [Candidatus Liberibacter sol 1 0.0
114705263517 cell division protein FtsZ [Fulvimarina pelagi HTCC2506 1 1e-140
241205548572 cell division protein FtsZ [Rhizobium leguminosarum bv. 1 1e-134
222149129 619 cell division protein FtsZ [Agrobacterium vitis S4] Len 1 1e-134
222086436588 cell division protein [Agrobacterium radiobacter K84] L 1 1e-134
162329636576 cell division protein FtsZ [Rhizobium etli CFN 42] Leng 1 1e-133
209550166571 cell division protein FtsZ [Rhizobium leguminosarum bv. 1 1e-133
190892576576 cell division protein [Rhizobium etli CIAT 652] Length 1 1e-133
116253039572 cell division protein FtsZ [Rhizobium leguminosarum bv. 1 1e-133
327194616576 cell division protein [Rhizobium etli CNPAF512] Length 1 1e-133
>gi|315122571|ref|YP_004063060.1| cell division protein FtsZ [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 509 Back     alignment and organism information
 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/510 (75%), Positives = 438/510 (85%), Gaps = 9/510 (1%)

Query: 1   MVGKNANMDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQ 60
           MV K++N+DITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNF+VANTDAQAL MSKA +
Sbjct: 1   MVEKHSNVDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFIVANTDAQALTMSKADR 60

Query: 61  IIQLGSGITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPII 120
           IIQLG+GIT GLGAGSHPEVGRAAAEECIDEIT +L+KTHMCFVTAGMGGGTGTGAAPII
Sbjct: 61  IIQLGTGITAGLGAGSHPEVGRAAAEECIDEITNILEKTHMCFVTAGMGGGTGTGAAPII 120

Query: 121 AKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKT 180
           AKIARNKGVLTVGVVTKPFHFEGSRRMRVAE+GIEALQETVDTLIVIPNQNLFRIA DKT
Sbjct: 121 AKIARNKGVLTVGVVTKPFHFEGSRRMRVAEAGIEALQETVDTLIVIPNQNLFRIATDKT 180

Query: 181 TFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRG 240
           TF DAFSMADQVLYSGVSCITDLMI+EGLINLDFADVRSVMRNMGRAMMGTGEASGHGRG
Sbjct: 181 TFVDAFSMADQVLYSGVSCITDLMIREGLINLDFADVRSVMRNMGRAMMGTGEASGHGRG 240

Query: 241 IQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGA 300
           IQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGA
Sbjct: 241 IQAAEAAVANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGA 300

Query: 301 TFDEALEGVIRVSVVATGIENRLHRDGDDN--RDSSLTTHESLKNAKFLNLSSPKLPVED 358
           TFDEALEGVIRVSVVATGI+NR HRD DD+  ++S  + +E  +N+K  N++S KL   D
Sbjct: 301 TFDEALEGVIRVSVVATGIDNRFHRDKDDDDQKNSLDSENEPFENSKLFNIASRKL-TND 359

Query: 359 SHVMHHSVIAENAHCTDNQEDLNN----QENSLVGDQNQELFLEEDVVPESSAPHRLISR 414
            HV H + + +++    N+E ++N    + +  V +  ++ F+ ED++PESS PHR + +
Sbjct: 360 HHVAHDNEVVKDSSLIQNKEMMDNINHDKTDVSVKEGEKDFFINEDIIPESSNPHRHVPK 419

Query: 415 --QRHSDSVEERGVMALIKRIAHSFGLHENIASEEDSVHMKSESTVSYLRERNPSISEES 472
                +  +EERGVMALIKRIAHSFGL E+I+++ DS  +K ++TVS L+E+  S  ++S
Sbjct: 420 ISIEENYPIEERGVMALIKRIAHSFGLREDISTKRDSAPLKDKATVSNLKEKIVSSPQDS 479

Query: 473 IDDFCVQSKPTVKCEEDKLEIPAFLRRQSH 502
            ++  VQSK     E+D+LEIPAFLRRQSH
Sbjct: 480 EENVHVQSKSPFNHEKDQLEIPAFLRRQSH 509


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|114705263|ref|ZP_01438171.1| cell division protein FtsZ [Fulvimarina pelagi HTCC2506] Length = 517 Back     alignment and organism information
>gi|241205548|ref|YP_002976644.1| cell division protein FtsZ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 572 Back     alignment and organism information
>gi|222149129|ref|YP_002550086.1| cell division protein FtsZ [Agrobacterium vitis S4] Length = 619 Back     alignment and organism information
>gi|222086436|ref|YP_002544970.1| cell division protein [Agrobacterium radiobacter K84] Length = 588 Back     alignment and organism information
>gi|162329636|ref|YP_470335.2| cell division protein FtsZ [Rhizobium etli CFN 42] Length = 576 Back     alignment and organism information
>gi|209550166|ref|YP_002282083.1| cell division protein FtsZ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 571 Back     alignment and organism information
>gi|190892576|ref|YP_001979118.1| cell division protein [Rhizobium etli CIAT 652] Length = 576 Back     alignment and organism information
>gi|116253039|ref|YP_768877.1| cell division protein FtsZ [Rhizobium leguminosarum bv. viciae 3841] Length = 572 Back     alignment and organism information
>gi|327194616|gb|EGE61466.1| cell division protein [Rhizobium etli CNPAF512] Length = 576 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target502 cell division protein FtsZ [Candidatus Liberibacter asi
PRK09330384 PRK09330, PRK09330, cell division protein FtsZ; Validat 1e-164
PRK13018378 PRK13018, PRK13018, cell division protein FtsZ; Provisi 1e-131
TIGR00065349 TIGR00065, ftsZ, cell division protein FtsZ 1e-106
COG0206338 COG0206, FtsZ, Cell division GTPase [Cell division and 1e-105
cd02191303 cd02191, FtsZ, FtsZ is a GTPase that is similar to the 5e-76
cd00286328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tu 3e-17
cd02202349 cd02202, FtsZ_type2, FtsZ is a GTPase that is similar t 1e-16
cd02201304 cd02201, FtsZ_type1, FtsZ is a GTPase that is similar t 1e-136
smart00864192 smart00864, Tubulin, Tubulin/FtsZ family, GTPase domain 6e-73
pfam00091210 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain 9e-40
smart00865120 smart00865, Tubulin_C, Tubulin/FtsZ family, C-terminal 4e-36
pfam1232797 pfam12327, FtsZ_C, FtsZ family, C-terminal domain 1e-34
TIGR03483121 TIGR03483, FtsZ_alphas_C, cell division protein FtsZ, a 3e-06
>gnl|CDD|181781 PRK09330, PRK09330, cell division protein FtsZ; Validated Back     alignment and domain information
>gnl|CDD|183844 PRK13018, PRK13018, cell division protein FtsZ; Provisional Back     alignment and domain information
>gnl|CDD|161687 TIGR00065, ftsZ, cell division protein FtsZ Back     alignment and domain information
>gnl|CDD|30555 COG0206, FtsZ, Cell division GTPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|100020 cd02191, FtsZ, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>gnl|CDD|100022 cd02202, FtsZ_type2, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|100021 cd02201, FtsZ_type1, FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>gnl|CDD|129097 smart00864, Tubulin, Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>gnl|CDD|143872 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>gnl|CDD|129098 smart00865, Tubulin_C, Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|152762 pfam12327, FtsZ_C, FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|163287 TIGR03483, FtsZ_alphas_C, cell division protein FtsZ, alphaProteobacterial C-terminal extension Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 502 cell division protein FtsZ [Candidatus Liberibacter asi
PRK09330387 cell division protein FtsZ; Validated 100.0
TIGR00065365 ftsZ cell division protein FtsZ; InterPro: IPR000158 In 100.0
PRK13018387 cell division protein FtsZ; Provisional 100.0
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the euka 100.0
cd02191303 FtsZ FtsZ is a GTPase that is similar to the eukaryotic 100.0
COG0206338 FtsZ Cell division GTPase [Cell division and chromosome 100.0
cd02202349 FtsZ_type2 FtsZ is a GTPase that is similar to the euka 100.0
cd00286328 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alph 99.76
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 95.04
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 94.98
smart00864192 Tubulin Tubulin/FtsZ family, GTPase domain. This domain 100.0
pfam00091210 Tubulin Tubulin/FtsZ family, GTPase domain. This family 99.93
cd06059382 Tubulin The tubulin superfamily includes five distinct 99.32
PTZ00012450 alpha-tubulin II; Provisional 99.22
cd02187425 beta_tubulin The tubulin superfamily includes five dist 99.22
PTZ00335451 alpha tubulin; Provisional 99.19
PTZ00011453 alpha tubulin I; Provisional 99.16
cd02189446 delta_tubulin The tubulin superfamily includes five dis 99.1
PRK13508309 tagatose-6-phosphate kinase; Provisional 92.76
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 92.58
smart00865120 Tubulin_C Tubulin/FtsZ family, C-terminal domain. This 99.95
pfam1232797 FtsZ_C FtsZ family, C-terminal domain. This family incl 99.94
cd02188431 gamma_tubulin Gamma-tubulin is a ubiquitous phylogeneti 99.28
cd02186434 alpha_tubulin The tubulin superfamily includes five dis 99.22
PTZ00010443 beta tubulin; Provisional 99.21
cd02190379 epsilon_tubulin The tubulin superfamily includes five d 99.16
COG5023443 Tubulin [Cytoskeleton] 98.73
TIGR03483121 FtsZ_alphas_C cell division protein FtsZ, alphaProteoba 98.02
KOG1374448 consensus 97.93
KOG1376407 consensus 91.33
PTZ00082322 L-lactate dehydrogenase; Provisional 96.67
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.61
PTZ00325313 malate dehydrogenase; Provisional 96.45
PRK05086312 malate dehydrogenase; Provisional 96.27
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.21
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 95.88
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 95.88
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 95.78
PRK06223312 malate dehydrogenase; Reviewed 95.78
PTZ00117313 malate dehydrogenase; Provisional 95.61
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.44
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 95.34
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 95.27
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 95.17
PRK08223287 hypothetical protein; Validated 95.08
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 95.05
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.96
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 94.54
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 93.94
TIGR01771302 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 93.85
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 91.17
PRK05442325 malate dehydrogenase; Provisional 91.06
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 90.19
PRK13937192 phosphoheptose isomerase; Provisional 95.84
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of the SI 95.54
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 92.9
PRK13938196 phosphoheptose isomerase; Provisional 92.35
PRK13936197 phosphoheptose isomerase; Provisional 91.12
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 95.83
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 95.57
PRK07502307 cyclohexadienyl dehydrogenase; Validated 91.03
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 90.19
KOG2013 603 consensus 94.93
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.16
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 93.1
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 92.51
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.99
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 91.35
PRK06249313 2-dehydropantoate 2-reductase; Provisional 91.14
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 91.01
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 93.31
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM prote 90.67
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ; InterPro: IPR000158 In bacteria, FtsZ , , is an essential cell division protein which appears to be involved in the initiation of this event Back     alignment and domain information
>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>cd02191 FtsZ FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>COG0206 FtsZ Cell division GTPase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02202 FtsZ_type2 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>smart00864 Tubulin Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>pfam00091 Tubulin Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PTZ00012 alpha-tubulin II; Provisional Back     alignment and domain information
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PTZ00335 alpha tubulin; Provisional Back     alignment and domain information
>PTZ00011 alpha tubulin I; Provisional Back     alignment and domain information
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>smart00865 Tubulin_C Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>pfam12327 FtsZ_C FtsZ family, C-terminal domain Back     alignment and domain information
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PTZ00010 beta tubulin; Provisional Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>COG5023 Tubulin [Cytoskeleton] Back     alignment and domain information
>TIGR03483 FtsZ_alphas_C cell division protein FtsZ, alphaProteobacterial C-terminal extension Back     alignment and domain information
>KOG1374 consensus Back     alignment and domain information
>KOG1376 consensus Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>pfam00899 ThiF ThiF family Back     alignment and domain information
>pfam05368 NmrA NmrA-like family Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 This entry represents the NAD-dependent L-lactate dehydrogenases from bacteria and eukaryotes Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK13937 phosphoheptose isomerase; Provisional Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>KOG2013 consensus Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF; InterPro: IPR012731 Members of the HesA/MoeB/ThiF family of proteins (IPR000594 from INTERPRO) include a number of members encoded in the midst of thiamine biosynthetic operons Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target502 cell division protein FtsZ [Candidatus Liberibacter asi
1rlu_A382 Mycobacterium Tuberculosis Ftsz In Complex With Gtp 2e-76
2q1x_A379 Crystal Structure Of Cell Division Protein Ftsz Fro 2e-76
2vaw_A394 Ftsz Pseudomonas Aeruginosa Gdp Length = 394 4e-75
1w5f_A353 Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Leng 1e-72
2vam_A382 Ftsz B. Subtilis Length = 382 1e-70
2rhh_A325 Synthetic Gene Encoded Bacillus Subtilis Ftsz With 2e-69
2r6r_1338 Aquifex Aeolicus Ftsz Length = 338 9e-69
1ofu_A320 Crystal Structure Of Sula:ftsz From Pseudomonas Aer 6e-74
1fsz_A372 Crystal Structure Of The Cell-Division Protein Ftsz 3e-69
1w58_1364 Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 4e-69
1w5e_A364 Ftsz W319y Mutant, P1 (M. Jannaschii) Length = 364 3e-68
>gi|52695387|pdb|1RLU|A Chain A, Mycobacterium Tuberculosis Ftsz In Complex With Gtp-Gamma-S Length = 382 Back     alignment and structure
 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 166/338 (49%), Positives = 219/338 (64%), Gaps = 1/338 (0%)

Query: 28  NAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEE 87
           NAVN M+  GL+GV F+  NTDAQAL+MS A   + +G   T GLGAG+ PEVGR AAE+
Sbjct: 25  NAVNRMIEQGLKGVEFIAINTDAQALLMSDADVKLDVGRDSTRGLGAGADPEVGRKAAED 84

Query: 88  CIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRM 147
             DEI E+L    M FVTAG GGGTGTG AP++A IAR  G LTVGVVT+PF FEG RR 
Sbjct: 85  AKDEIEELLRGADMVFVTAGEGGGTGTGGAPVVASIARKLGALTVGVVTRPFSFEGKRRS 144

Query: 148 RVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFSMADQVLYSGVSCITDLMIKE 207
             AE+GI AL+E+ DTLIVIPN  L ++ +   +  DAF  AD+VL +GV  ITDL+   
Sbjct: 145 NQAENGIAALRESCDTLIVIPNDRLLQMGDAAVSLMDAFRSADEVLLNGVQGITDLITTP 204

Query: 208 GLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPLLDEASMKGSQGLLIS 267
           GLIN+DFADV+ +M   G A+MG G A G GR ++AAE A+ +PLL EASM+G+QG+L+S
Sbjct: 205 GLINVDFADVKGIMSGAGTALMGIGSARGEGRSLKAAEIAINSPLL-EASMEGAQGVLMS 263

Query: 268 ITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENRLHRDG 327
           I GGSDL LFE++EAA+ +++    +ANII G   D++L   +RV+V+A G +       
Sbjct: 264 IAGGSDLGLFEINEAASLVQDAAHPDANIIFGTVIDDSLGDEVRVTVIAAGFDVSGPGRK 323

Query: 328 DDNRDSSLTTHESLKNAKFLNLSSPKLPVEDSHVMHHS 365
               ++          A  L  +  +     S  +H +
Sbjct: 324 PVMGETGGAHRIESAKAGKLTSTLFEPVDAVSVPLHTN 361


gi|187609053|pdb|2Q1X|A Chain A, Crystal Structure Of Cell Division Protein Ftsz From Mycobacterium Tuberculosis In Complex With Citrate. Length = 379 Back     alignment and structure
gi|158431174|pdb|2VAW|A Chain A, Ftsz Pseudomonas Aeruginosa Gdp Length = 394 Back     alignment and structure
>gi|58177126|pdb|1W5F|A Chain A, Ftsz, T7 Mutated, Domain Swapped (T. Maritima) Length = 353 Back     alignment and structure
>gi|158431169|pdb|2VAM|A Chain A, Ftsz B. Subtilis Length = 382 Back     alignment and structure
>gi|209870277|pdb|2RHH|A Chain A, Synthetic Gene Encoded Bacillus Subtilis Ftsz With Bound Sulfate Ion Length = 325 Back     alignment and structure
>gi|158430648|pdb|2R6R|1 Chain 1, Aquifex Aeolicus Ftsz Length = 338 Back     alignment and structure
>gi|33357724|pdb|1OFU|A Chain A, Crystal Structure Of Sula:ftsz From Pseudomonas Aeruginosa Length = 320 Back     alignment and structure
>gi|157831135|pdb|1FSZ|A Chain A, Crystal Structure Of The Cell-Division Protein Ftsz At 2.8a Resolution Length = 372 Back     alignment and structure
gi|58177090|pdb|1W58|1 Chain 1, Ftsz Gmpcpp Soak I213 (M. Jannaschii) Length = 364 Back     alignment and structure
>gi|58177117|pdb|1W5E|A Chain A, Ftsz W319y Mutant, P1 (M. Jannaschii) Length = 364 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target502 cell division protein FtsZ [Candidatus Liberibacter asi
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell divisi 1e-108
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polymerizat 2e-88
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP-bind 9e-88
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, inhib 2e-86
3m89_A427 FTSZ/tubulin-related protein; partition, TUBZ, GTP-bind 2e-48
2vaw_A394 FTSZ, cell division protein FTSZ; bacterial cell divisi 7e-87
2vxy_A382 FTSZ, cell division protein FTSZ; GTP-binding, nucleoti 1e-86
1rq2_A382 Cell division protein FTSZ; cell cycle, tubulin, GTPase 2e-84
2btq_B426 Tubulin btubb; structural protein, cytoskeletal protein 4e-06
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 320 Back     alignment and structure
 Score =  388 bits (999), Expect = e-108
 Identities = 152/316 (48%), Positives = 213/316 (67%)

Query: 8   MDITELKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSG 67
           +D       I V GV     NAVN+M  + ++GV F+ ANTDAQAL    A+ ++QLG G
Sbjct: 5   VDNIAQTAVIKVIGVXXXXXNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPG 64

Query: 68  ITEGLGAGSHPEVGRAAAEECIDEITEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNK 127
           +T+GLGAG++PEVGR AA E  + I+E+L+   M F+T GMGGGTGTGAAPIIA++A+  
Sbjct: 65  VTKGLGAGANPEVGRQAALEDRERISEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEM 124

Query: 128 GVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNLFRIANDKTTFADAFS 187
           G+LTV VVT+PF FEG +RM++A+ GI AL E+VD+LI IPN+ L  I     +   AF+
Sbjct: 125 GILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKLLTILGKDASLLAAFA 184

Query: 188 MADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAA 247
            AD VL   V  I+D++ + G+IN+DFADV++VM  MG AMMGTG ASG  R  +A EAA
Sbjct: 185 KADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAA 244

Query: 248 VANPLLDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALE 307
           + NPLL++ +++G++G+L++IT G DL+L E  +    I +     A + +G   D  + 
Sbjct: 245 IRNPLLEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMR 304

Query: 308 GVIRVSVVATGIENRL 323
             + V+VVATG+  RL
Sbjct: 305 DELHVTVVATGLGARL 320


>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Length = 364 Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Length = 353 Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Length = 338 Back     alignment and structure
>3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A Length = 427 Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Length = 394 Back     alignment and structure
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Length = 382 Back     alignment and structure
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Length = 382 Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Length = 426 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target502 cell division protein FtsZ [Candidatus Liberibacter asi
2vaw_A394 FTSZ, cell division protein FTSZ; bacterial cell divisi 100.0
1rq2_A382 Cell division protein FTSZ; cell cycle, tubulin, GTPase 100.0
2vxy_A382 FTSZ, cell division protein FTSZ; GTP-binding, nucleoti 100.0
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell divisi 100.0
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polymerizat 100.0
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP-bind 100.0
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, inhib 100.0
3m89_A427 FTSZ/tubulin-related protein; partition, TUBZ, GTP-bind 100.0
1tvk_A440 Tubulin alpha chain; epothilone, taxol, ligand interact 99.22
2btq_B426 Tubulin btubb; structural protein, cytoskeletal protein 99.22
2bto_A473 Tubulin btuba; bacterial tubulin, polymerization, cytos 99.19
3cb2_A475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microt 99.11
1tvk_B427 Tubulin beta chain; epothilone, taxol, ligand interacti 98.77
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic acid, 96.94
3ic5_A118 Putative saccharopine dehydrogenase; structural genomic 95.71
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; alpha- 94.65
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microcin, pr 94.23
3fi9_A343 Malate dehydrogenase; structural genomics, oxidoreducta 94.13
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A 93.99
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossman fo 93.83
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, sacc 93.76
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1.90A { 93.4
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 91.65
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane prot 91.54
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: modified 91.44
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenase, ox 91.11
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, protein-pr 90.28
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha-amin 90.13
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA cycle 90.12
3fef_A450 Putative glucosidase LPLD; gulosidase, structural genom 96.57
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural genom 95.79
2yva_A196 DNAA initiator-associating protein DIAA; intermolecular 94.99
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hydrolas 94.44
1tk9_A188 Phosphoheptose isomerase 1; lipopolysaccharide biosynth 94.26
1vjt_A483 Alpha-glucosidase; TM0752, structural genomics, JCSG, P 93.05
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genomics, 92.63
1x92_A199 APC5045, phosphoheptose isomerase; midwest centre for s 92.26
2xbl_A198 Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1. 91.11
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); H 96.55
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzyme, s 96.21
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, oxidor 96.15
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, 96.14
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer 95.84
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)) 95.56
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sandwic 95.46
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxylic aci 95.36
2hjr_A328 Malate dehydrogenase; malaria, structural genomics, str 95.15
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxylic aci 95.15
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, rossman 95.14
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysis, hy 95.07
2ldx_A331 APO-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A 94.99
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolys 94.93
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydr 94.77
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory for st 94.71
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxidoredu 94.43
2v7p_A310 L-lactate dehydrogenase; oxidoreductase, phosphorylatio 94.25
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, 94.23
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatation, 94.2
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding, pro 94.11
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding doma 94.01
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreductase; H 93.62
2v65_A331 LDH-A, L-lactate dehydrogenase A chain; oxidoreductase, 93.58
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, radiore 93.53
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, HAEM d 93.3
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarboxyli 93.17
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; structura 92.95
6ldh_A330 M4 APO-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 92.67
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, oxidor 92.54
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor anal 90.67
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodim 94.64
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 93.22
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 cata 91.93
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=876.27  Aligned_cols=310  Identities=50%  Similarity=0.831  Sum_probs=306.0

Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHCCCCCCEEEEECCCHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             38617999966814799999998589984499982557885518997048515542556788888389999999729999
Q gi|254781176|r   13 LKPRITVFGVGGGGGNAVNNMVSSGLQGVNFVVANTDAQALMMSKAKQIIQLGSGITEGLGAGSHPEVGRAAAEECIDEI   92 (502)
Q Consensus        13 ~~~~i~v~g~gg~g~n~~~~~~~~~~~~~~~~~~ntd~~~l~~~~~~~~~~~g~~~~~g~g~g~~~~~g~~~a~~~~~~i   92 (502)
                      -+.+||||||||||||+||||++.++.+|+|||+|||+|||.+|++++|||||.++||||||||||++||+||+|+.++|
T Consensus        10 ~~~~ikviGvGG~G~N~v~~m~~~~~~~v~~ia~NTD~q~L~~~~~~~ki~iG~~~t~G~GaG~~p~~g~~aa~~~~~~i   89 (394)
T 2vaw_A           10 QTAVIKVIGVGGGGGNAVNHMAKNNVEGVEFICANTDAQALKNIAARTVLQLGPGVTKGLGAGANPEVGRQAALEDRERI   89 (394)
T ss_dssp             TTCCEEEEEEHHHHHHHHHHHHTTTCCSEEEEEEESCTTTTSSCSSSCEEECCHHHHSSSCCCSCHHHHHHHHHHTHHHH
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHCCCCCCEEEEEECCHHHHHCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             88648999847773789999997499983699993739988359998179607876678899888689999999709999


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99726998999980367666740789999999864984999950430004067888899999999986333545027888
Q gi|254781176|r   93 TEMLDKTHMCFVTAGMGGGTGTGAAPIIAKIARNKGVLTVGVVTKPFHFEGSRRMRVAESGIEALQETVDTLIVIPNQNL  172 (502)
Q Consensus        93 ~~~~~~~~~~~~~ag~gggtgtg~~p~ia~~a~~~~~~~~~~v~~pf~~eg~~r~~~a~~~~~~l~~~~d~~i~i~n~~l  172 (502)
                      +++|+++||||||||||||||||||||||++||++|+|||+|||+||.|||++|+++|++||++|+++||++||||||||
T Consensus        90 ~~~l~~~d~vfi~aGmGGGTGtGaapviA~~Ake~g~ltv~ivt~PF~~Eg~~r~~~A~~gi~~L~~~~D~~Ivi~Nd~L  169 (394)
T 2vaw_A           90 SEVLEGADMVFITTGMGGGTGTGAAPIIAEVAKEMGILTVAVVTRPFPFEGRKRMQIADEGIRALAESVDSLITIPNEKL  169 (394)
T ss_dssp             HHHHTTCSEEEEEEETTSSHHHHHHHHHHHHHHHHTCEEEEEEEECCGGGHHHHHHHHHHHHHHHHTTCSEEEEEEHHHH
T ss_pred             HHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHH
T ss_conf             99857888899973389987554689999999981980899930886773178999999999999964481799866899


Q ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHHHHCCC
Q ss_conf             74136653189997446799999988888765166555589878787641586589987614862048999988752701
Q gi|254781176|r  173 FRIANDKTTFADAFSMADQVLYSGVSCITDLMIKEGLINLDFADVRSVMRNMGRAMMGTGEASGHGRGIQAAEAAVANPL  252 (502)
Q Consensus       173 ~~~~~~~~~~~~af~~~d~~l~~~v~~i~~~i~~~g~in~df~d~~~v~~~~g~a~~g~g~~~g~~r~~~a~~~a~~~pl  252 (502)
                      ++++++++++.+||+++|++|+++|+||+++|++||+|||||+|||+||+++|.|+||+|+++|++|+.+|+++||+|||
T Consensus       170 ~~~~~~~~~~~~af~~ad~il~~~v~gI~~ii~~~g~INvDfaDvktvm~~~G~a~~G~G~a~G~~ra~~A~~~Al~spl  249 (394)
T 2vaw_A          170 LTILGKDASLLAAFAKADDVLAGAVRGISDIIKRPGMINVDFADVKTVMSEMGMAMMGTGCASGPNRAREATEAAIRNPL  249 (394)
T ss_dssp             HHHHGGGCCHHHHHHHHHHHHHHHHHHHHHHHHSBCSSCCCHHHHHHHHTTTCCBEEEEEEECSTTHHHHHHHHHHTCGG
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCEEEEEEEEECCCCHHHHHHHHHHHCCC
T ss_conf             87726798799999999999999988789861488733466899999970698499998886687329999999984665


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCEEEEEEEEECCCCC
Q ss_conf             0002245553789996168888999999999999974168863999853134657547999985135532
Q gi|254781176|r  253 LDEASMKGSQGLLISITGGSDLTLFEVDEAATRIREEVDSEANIILGATFDEALEGVIRVSVVATGIENR  322 (502)
Q Consensus       253 l~~~~~~~a~~~l~~i~~~~~~~l~e~~~~~~~i~~~~~~~a~ii~G~~~d~~~~~~~~v~~iatg~d~~  322 (502)
                      |++.+|+|||++||||+||++++|.|+++++++|++.++++|+||||+++|++|++++|||||||||+..
T Consensus       250 L~~~~i~~A~~vLvni~gg~d~~l~ev~~~~~~I~~~~~~~a~ii~G~~~d~~l~~~i~VtiIATG~~~~  319 (394)
T 2vaw_A          250 LEDVNLQGARGILVNITAGPDLSLGEYSDVGNIIEQFASEHATVKVGTVIDADMRDELHVTVVATGLGAR  319 (394)
T ss_dssp             GTTCCTTTCSEEEEEEEECTTCCHHHHHHHHHHHHHHSCTTSEEEEEEEECSSCCSCEEEEEEEECC---
T ss_pred             CCCCCHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCEEEEEEECCCCCC
T ss_conf             5577801064337999558887799999999889874278985999877875458975999998478865



>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Back     alignment and structure
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Back     alignment and structure
>3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A Back     alignment and structure
>1tvk_A Tubulin alpha chain; epothilone, taxol, ligand interactions, cell cycle, structural protein; HET: GDP GTP EP; 2.89A {Bos taurus} SCOP: c.32.1.1 d.79.2.1 PDB: 1tub_A* 1jff_A* 2wbe_A* 3dco_A* 3edl_A* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* 2p4n_A* 1sa0_A* 1sa1_A* 3edl_F* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1z2b_A* ... Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein complex, cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Back     alignment and structure
>1tvk_B Tubulin beta chain; epothilone, taxol, ligand interactions, cell cycle, structural protein; HET: GDP GTP EP; 2.89A {Bos taurus} SCOP: c.32.1.1 d.79.2.1 PDB: 1tub_B* 1jff_B* 1ia0_B* 1ffx_B* 1sa0_B* 1sa1_B* 2hxf_B* 2hxh_B* 2p4n_B* 2wbe_B* 3dco_B* 3edl_B* 1z2b_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* ... Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, PSI-2, protein structure initiative; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Porphyromonas gingivalis atcc 33277} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transferase, structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2jfg_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding motifs, MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, transferase/biosynthetic protein complex; 1.98A {Escherichia coli K12} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initiative; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, NAD dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>1tk9_A Phosphoheptose isomerase 1; lipopolysaccharide biosynthesis, structural genomics, NYSGXRC, LPC1_camje, PSI, protein structure initiative; 2.10A {Campylobacter jejuni} SCOP: c.80.1.3 Back     alignment and structure
>1vjt_A Alpha-glucosidase; TM0752, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics, hydrolase; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1x92_A APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} SCOP: c.80.1.3 PDB: 3bjz_A Back     alignment and structure
>2xbl_A Phosphoheptose isomerase; capsule; HET: M7P PGE PG4; 1.62A {Burkholderia pseudomallei} PDB: 2x3y_A Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii ME49} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 1llc_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure