254781177

254781177

cell division protein

GeneID in NCBI database:8210202Locus tag:CLIBASIA_05420
Protein GI in NCBI database:254781177Protein Accession:YP_003065590.1
Gene range:-(1176683, 1178005)Protein Length:440aa
Gene description:cell division protein
COG prediction:[D] Actin-like ATPase involved in cell division
KEGG prediction:ftsA; cell division protein; K03590 cell division protein FtsA
SEED prediction:Cell division protein FtsA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division;
Bacterial Cytoskeleton
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS
ccEEEEEHHccccHHcccccccEEEEEEccccEEEEEEEEccccccEEccccccccEEEEEEEcccccccccccEEcHHHHHHHHHHHHHHHHHHcccccccEEEEccccccEEccccEEEEcccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEEccHHHHHHHHcccccEEEEEEEEEEHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHcccccccccEEEEEccccEEEEEEEEcccEEEEEEEEcccccHHHHHHHHHcccHHHHHHHHHHHcccccccccccEEEEEcccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcHHcccHHHHHHHHHHHcccEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccc
cEEEccccccccccccHcccccEEEEEEccccEEEEEEEEEccccccEEccccEEEEEEEEEccccccccccccEEcHHHHHHHHHHHHHHHHHHccccEEEEEEEEccccEEcccccEEEEcccccccHHHHHHHHHHHHcccccHHccEEEEEcccEEEEEcccccccccccccEEEEEEEEEEEccHHHHHHHHHHHHHccccHHHHEEcHHHHHHHHHcHcHHHccEEEEEcccccEEEEEEEcccEEEEEEEEcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEcccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccEEEcccccccccHHHHHHHHHccccEEccccccccccHHccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccc
msiftmpfssqytgcllsnRTYIVSALDIGSTKTVCMigklvpqnttsllsgrtHRIEvigigcqqshgvkmgtivDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMkigwrevndSDIQILLKSSFRRYLRDQKRTLLHSIITDyaldgksgikspismfADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVaspyasglatlvddefELGSVVidmgggttkiaIFDKGKLVYMDVIAIGGSHVTNDLARGLsisldnaerlkvmhpsiipsladehdilsiptignadhndLVQVSRAMISRIIQARIEETFELIGERIkksgfsslaSKRIVLTGGASQVIGLQEMLRETICSnvrmgrpigavglpfsarspaFSTVIGlmiypqliakevdcgeeyssfwskrqfspfinwfrkss
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIgigcqqshgvKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKigwrevndsDIQILLKSSFRRYLRDQKRTLLHSIItdyaldgksgIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERikksgfsslasKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSfwskrqfspfinwfrkss
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS
************************SALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSI*************VSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYP**************************NWFRK**
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKE***************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS
MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVIGIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVEMKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIGIESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDILSIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGASQVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVDCGEEYSSFWSKRQFSPFINWFRKSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target440 cell division protein [Candidatus Liberibacter asiaticu
255764494 652 molecular chaperone DnaK [Candidatus Liberibacter 4e-05
>gi|255764494|ref|YP_003065050.2| molecular chaperone DnaK [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Back     alignment
 Score = 40.8 bits (94), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 89/192 (46%), Gaps = 25/192 (13%)

Query: 203 AHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGTTKIAIFDKGKLVYMDVIAIGG- 261
           A L V R++  P A+ LA  +D +     +V D GGGT  +++ + G  V+ +V A  G 
Sbjct: 161 AGLDVLRIINEPTAAALAYGLDKKDARTVIVFDFGGGTFDVSLLEMGDGVF-EVKATNGD 219

Query: 262 -------------SHVTNDLAR--GLSISLDN--AERLK-VMHPSIIPSLADEHDILSIP 303
                         H+ +   +  G+ +  D    +RLK     + I   +     +++P
Sbjct: 220 TFLGGEDFDSCLVEHICDTFKKENGIDLKQDTLALQRLKEAAEKAKIELSSTSQTEINLP 279

Query: 304 TI----GNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGA 359
            I      A H ++ +++RA   R++   I++T E   + ++ +G S      +VL GG 
Sbjct: 280 FISANSAGAQHLNM-KLTRAQFERLVNHLIQKTVEPCKKCLQDAGLSPSDIDEVVLVGGM 338

Query: 360 SQVIGLQEMLRE 371
           +++  +Q+ +++
Sbjct: 339 TRMPKIQQSVQD 350

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target440 cell division protein [Candidatus Liberibacter asiaticu
315122572432 cell division protein [Candidatus Liberibacter solanace 1 0.0
15965922442 cell division protein [Sinorhizobium meliloti 1021] Len 1 1e-132
150397276442 cell division protein FtsA [Sinorhizobium medicae WSM41 1 1e-131
227822646443 cell division protein FtsA [Sinorhizobium fredii NGR234 1 1e-131
15889371443 cell division protein [Agrobacterium tumefaciens str. C 1 1e-130
325293458443 cell division protein [Agrobacterium sp. H13-3] Length 1 1e-130
222086437443 cell division protein [Agrobacterium radiobacter K84] L 1 1e-127
222149130441 cell division protein [Agrobacterium vitis S4] Length = 1 1e-127
190892577443 cell division protein [Rhizobium etli CIAT 652] Length 1 1e-127
86358444443 cell division protein [Rhizobium etli CFN 42] Length = 1 1e-127
>gi|315122572|ref|YP_004063061.1| cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 432 Back     alignment and organism information
 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/431 (72%), Positives = 371/431 (86%), Gaps = 3/431 (0%)

Query: 1   MSIFTMPFSSQYTGCLLSNRTYIVSALDIGSTKTVCMIGKLVPQNTTSLLSGRTHRIEVI 60
           MSIFT+PF SQY   L S+RTYI+S LDIGSTKTVCMIGKL P+  T LL G TH+IE+I
Sbjct: 1   MSIFTIPFDSQYISGLSSHRTYIISVLDIGSTKTVCMIGKLFPKKATDLLPGTTHQIEII 60

Query: 61  GIGCQQSHGVKMGTIVDIDAVERVVRQVVDAAERMAGFTVDNLLVNISAGCLKSQQHFVE 120
           GIGCQQS GVKMG+IVD+DAVERVVRQVVD+AE+MAG  VD+LLVN+S+G L+S +H+VE
Sbjct: 61  GIGCQQSQGVKMGSIVDLDAVERVVRQVVDSAEQMAGCIVDSLLVNVSSGHLESSRHYVE 120

Query: 121 MKIGWREVNDSDIQILLKSSFRRYLRDQKRTLLHSIITDYALDGKSGIKSPISMFADKIG 180
           MKIGWREV  SDI  L+K S +RY   Q RTLLHS+++DY+LDGKSGIKSPISMF +K+G
Sbjct: 121 MKIGWREVKKSDIHTLIKYS-KRYSCGQNRTLLHSMVSDYSLDGKSGIKSPISMFGEKVG 179

Query: 181 IESHLLTVEKSSMKNLERAINRAHLSVERMVASPYASGLATLVDDEFELGSVVIDMGGGT 240
           ++ H+++VEKS+++NLE AINR+HLSV +MVASPYASGLA LVDDEF+LG +VIDMGGGT
Sbjct: 180 VDMHMVSVEKSALRNLEVAINRSHLSVAKMVASPYASGLAVLVDDEFDLGCIVIDMGGGT 239

Query: 241 TKIAIFDKGKLVYMDVIAIGGSHVTNDLARGLSISLDNAERLKVMHPSIIPSLADEHDIL 300
           TKIA+F++GKLVY D+IAIGGSHVTNDLARGLSIS +NAERLKVMH S+IPSLADEHDIL
Sbjct: 240 TKIAVFNEGKLVYTDMIAIGGSHVTNDLARGLSISRENAERLKVMHASVIPSLADEHDIL 299

Query: 301 SIPTIGNADHNDLVQVSRAMISRIIQARIEETFELIGERIKKSGFSSLASKRIVLTGGAS 360
           SIP I + D N+ VQ SRAMISRI++ARIEE FELI  RI KSGF SLA KRIVLTGGAS
Sbjct: 300 SIPAIVDDDQNNPVQASRAMISRIVRARIEEIFELISGRIHKSGFGSLAGKRIVLTGGAS 359

Query: 361 QVIGLQEMLRETICSNVRMGRPIGAVGLPFSARSPAFSTVIGLMIYPQLIAKEVD-CGEE 419
           Q+IGLQEM+R+ + SNVR+G+P+G  GLPFSAR  AFST IGLM+YPQL+AKEVD  GE+
Sbjct: 360 QLIGLQEMIRQMVRSNVRIGKPMGIAGLPFSARGAAFSTAIGLMLYPQLVAKEVDYIGED 419

Query: 420 YSSF-WSKRQF 429
           YS F W K++F
Sbjct: 420 YSFFRWDKKRF 430


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15965922|ref|NP_386275.1| cell division protein [Sinorhizobium meliloti 1021] Length = 442 Back     alignment and organism information
>gi|150397276|ref|YP_001327743.1| cell division protein FtsA [Sinorhizobium medicae WSM419] Length = 442 Back     alignment and organism information
>gi|227822646|ref|YP_002826618.1| cell division protein FtsA [Sinorhizobium fredii NGR234] Length = 443 Back     alignment and organism information
>gi|15889371|ref|NP_355052.1| cell division protein [Agrobacterium tumefaciens str. C58] Length = 443 Back     alignment and organism information
>gi|325293458|ref|YP_004279322.1| cell division protein [Agrobacterium sp. H13-3] Length = 443 Back     alignment and organism information
>gi|222086437|ref|YP_002544971.1| cell division protein [Agrobacterium radiobacter K84] Length = 443 Back     alignment and organism information
>gi|222149130|ref|YP_002550087.1| cell division protein [Agrobacterium vitis S4] Length = 441 Back     alignment and organism information
>gi|190892577|ref|YP_001979119.1| cell division protein [Rhizobium etli CIAT 652] Length = 443 Back     alignment and organism information
>gi|86358444|ref|YP_470336.1| cell division protein [Rhizobium etli CFN 42] Length = 443 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target440 cell division protein [Candidatus Liberibacter asiaticu
TIGR01174371 TIGR01174, ftsA, cell division protein FtsA 4e-79
PRK09472420 PRK09472, ftsA, cell division protein FtsA; Reviewed 7e-53
COG0849418 COG0849, FtsA, Actin-like ATPase involved in cell divis 1e-97
smart00842187 smart00842, FtsA, Cell division protein FtsA 7e-48
pfam02491163 pfam02491, FtsA, Cell division protein FtsA 9e-19
pfam02491163 pfam02491, FtsA, Cell division protein FtsA 3e-27
PRK13930335 PRK13930, PRK13930, rod shape-determining protein MreB; 2e-07
pfam06723327 pfam06723, MreB_Mbl, MreB/Mbl protein 3e-07
COG4972354 COG4972, PilM, Tfp pilus assembly protein, ATPase PilM 7e-05
PRK13927334 PRK13927, PRK13927, rod shape-determining protein MreB; 2e-04
PRK13929335 PRK13929, PRK13929, rod-share determining protein MreBH 2e-04
TIGR01991 599 TIGR01991, HscA, Fe-S protein assembly chaperone HscA 0.002
TIGR01175348 TIGR01175, pilM, type IV pilus assembly protein PilM 0.002
PRK13411 653 PRK13411, PRK13411, molecular chaperone DnaK; Provision 0.003
PRK13928336 PRK13928, PRK13928, rod shape-determining protein Mbl; 0.003
PRK15080267 PRK15080, PRK15080, ethanolamine utilization protein Eu 4e-09
COG1077342 COG1077, MreB, Actin-like ATPase involved in cell morph 1e-08
COG0443 579 COG0443, DnaK, Molecular chaperone [Posttranslational m 5e-08
TIGR00904333 TIGR00904, mreB, cell shape determining protein, MreB/M 7e-06
COG4820277 COG4820, EutJ, Ethanolamine utilization protein, possib 2e-08
TIGR02529239 TIGR02529, EutJ, ethanolamine utilization protein EutJ 6e-08
COG4819 473 COG4819, EutA, Ethanolamine utilization protein, possib 0.002
PRK10719 475 PRK10719, eutA, reactivating factor for ethanolamine am 0.002
pfam06277 473 pfam06277, EutA, Ethanolamine utilisation protein EutA 0.002
>gnl|CDD|162236 TIGR01174, ftsA, cell division protein FtsA Back     alignment and domain information
>gnl|CDD|181887 PRK09472, ftsA, cell division protein FtsA; Reviewed Back     alignment and domain information
>gnl|CDD|31190 COG0849, FtsA, Actin-like ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129075 smart00842, FtsA, Cell division protein FtsA Back     alignment and domain information
>gnl|CDD|145564 pfam02491, FtsA, Cell division protein FtsA Back     alignment and domain information
>gnl|CDD|145564 pfam02491, FtsA, Cell division protein FtsA Back     alignment and domain information
>gnl|CDD|184404 PRK13930, PRK13930, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|115385 pfam06723, MreB_Mbl, MreB/Mbl protein Back     alignment and domain information
>gnl|CDD|34578 COG4972, PilM, Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|184401 PRK13927, PRK13927, rod shape-determining protein MreB; Provisional Back     alignment and domain information
>gnl|CDD|184403 PRK13929, PRK13929, rod-share determining protein MreBH; Provisional Back     alignment and domain information
>gnl|CDD|162645 TIGR01991, HscA, Fe-S protein assembly chaperone HscA Back     alignment and domain information
>gnl|CDD|162237 TIGR01175, pilM, type IV pilus assembly protein PilM Back     alignment and domain information
>gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional Back     alignment and domain information
>gnl|CDD|184402 PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>gnl|CDD|185038 PRK15080, PRK15080, ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>gnl|CDD|31275 COG1077, MreB, Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|30792 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129982 TIGR00904, mreB, cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>gnl|CDD|34429 COG4820, EutJ, Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131581 TIGR02529, EutJ, ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>gnl|CDD|34428 COG4819, EutA, Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182674 PRK10719, eutA, reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>gnl|CDD|148092 pfam06277, EutA, Ethanolamine utilisation protein EutA Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 440 cell division protein [Candidatus Liberibacter asiaticu
PRK09472420 ftsA cell division protein FtsA; Reviewed 100.0
COG0849418 ftsA Cell division ATPase FtsA [Cell division and chrom 100.0
TIGR01174393 ftsA cell division protein FtsA; InterPro: IPR003494 Ft 100.0
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell moti 100.0
TIGR00904337 mreB cell shape determining protein, MreB/Mrl family; I 100.0
TIGR02529240 EutJ ethanolamine utilization protein EutJ family prote 100.0
TIGR02350 598 prok_dnaK chaperone protein DnaK; InterPro: IPR012725 M 99.95
COG4820277 EutJ Ethanolamine utilization protein, possible chapero 99.95
PRK13411 655 molecular chaperone DnaK; Provisional 99.94
PRK01433 595 hscA chaperone protein HscA; Provisional 99.93
TIGR01991 628 HscA Fe-S protein assembly chaperone HscA; InterPro: IP 99.84
TIGR01175381 pilM type IV pilus assembly protein PilM; InterPro: IPR 99.82
KOG0104 902 consensus 99.35
TIGR01312494 XylB xylulokinase; InterPro: IPR006000 The ability to m 96.27
TIGR01311518 glycerol_kin glycerol kinase; InterPro: IPR005999 Glyce 95.89
smart00842187 FtsA Cell division protein FtsA. FtsA is essential for 100.0
pfam02491163 FtsA Cell division protein FtsA. FtsA is essential for 99.83
PRK13928325 rod shape-determining protein Mbl; Provisional 100.0
PRK13930336 rod shape-determining protein MreB; Provisional 100.0
PRK13929335 rod-share determining protein MreBH; Provisional 100.0
PRK13927338 rod shape-determining protein MreB; Provisional 100.0
pfam06723327 MreB_Mbl MreB/Mbl protein. This family consists of bact 100.0
COG1077342 MreB Actin-like ATPase involved in cell morphogenesis [ 99.97
pfam00012 598 HSP70 Hsp70 protein. Hsp70 chaperones help to fold many 99.95
CHL00094 622 dnaK heat shock protein 70 99.95
PRK00290 631 dnaK molecular chaperone DnaK; Provisional 99.95
PRK13410 719 molecular chaperone DnaK; Provisional 99.95
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 99.95
PRK05183 621 hscA chaperone protein HscA; Provisional 99.94
PTZ00009 657 heat shock 70 kDa protein; Provisional 99.92
PRK11678450 putative chaperone; Provisional 99.92
COG0443 579 DnaK Molecular chaperone [Posttranslational modificatio 99.91
KOG0100 663 consensus 99.72
KOG0101 620 consensus 99.61
KOG0103 727 consensus 99.56
cd00012371 ACTIN Actin; An ubiquitous protein involved in the form 99.42
PTZ00004375 actin; Provisional 99.35
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarkinase/ 99.29
pfam06406318 StbA StbA protein. This family consists of several bact 99.26
pfam08841332 DDR Diol dehydratase reactivase ATPase-like domain. Dio 99.25
pfam00022369 Actin Actin. 99.2
PRK13917346 plasmid segregation protein ParM; Provisional 99.16
PTZ00281376 actin; Provisional 99.1
COG5277444 Actin and related proteins [Cytoskeleton] 98.61
pfam02491163 FtsA Cell division protein FtsA. FtsA is essential for 99.95
PRK10719 471 eutA reactivating factor for ethanolamine ammonia lyase 99.09
pfam06277 473 EutA Ethanolamine utilisation protein EutA. This family 99.01
COG1548330 Predicted transcriptional regulator/sugar kinase [Trans 96.5
PRK13319258 consensus 93.24
PRK13323258 consensus 92.94
pfam03702363 UPF0075 Uncharacterized protein family (UPF0075). The p 92.07
PRK13321256 pantothenate kinase; Reviewed 90.87
KOG0102 640 consensus 99.42
PTZ00280416 actin; Provisional 98.71
KOG0676372 consensus 97.79
pfam11104146 Competence_A Competence protein A. Competence protein A 99.23
TIGR03192293 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subuni 99.14
COG1924396 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-c 99.09
TIGR03286404 methan_mark_15 putative methanogenesis marker protein 1 99.03
pfam01968285 Hydantoinase_A Hydantoinase/oxoprolinase. This family i 97.98
TIGR00241259 CoA_E_activ CoA-substrate-specific enzyme activase, put 95.21
PRK13317273 pantothenate kinase; Provisional 94.04
PRK11031 494 guanosine pentaphosphate phosphohydrolase; Provisional 99.02
PRK10854 513 exopolyphosphatase; Provisional 98.83
COG0248 492 GppA Exopolyphosphatase [Nucleotide transport and metab 98.53
COG4819 473 EutA Ethanolamine utilization protein, possible chapero 97.94
pfam02541285 Ppx-GppA Ppx/GppA phosphatase family. This family consi 97.71
KOG0680400 consensus 97.09
KOG0681 645 consensus 97.02
PRK13324258 pantothenate kinase; Reviewed 93.3
PRK13334262 consensus 90.94
pfam07520 999 SrfB Virulence factor SrfB. This family includes homolo 98.41
COG4457 1014 SrfB Uncharacterized protein conserved in bacteria, put 97.19
KOG0681645 consensus 96.65
TIGR02628473 fuculo_kin_coli L-fuculokinase; InterPro: IPR013450 Pro 94.77
COG1070502 XylB Sugar (pentulose and hexulose) kinases [Carbohydra 98.17
PRK00047498 glpK glycerol kinase; Provisional 96.78
pfam00370245 FGGY_N FGGY family of carbohydrate kinases, N-terminal 96.48
PRK09698302 D-allose kinase; Provisional 95.77
PRK04123 542 ribulokinase; Provisional 95.31
PRK10939 521 autoinducer-2 (AI-2) kinase; Provisional 95.22
PRK13311256 N-acetyl-D-glucosamine kinase; Provisional 94.76
PRK13310302 N-acetyl-D-glucosamine kinase; Provisional 94.53
COG2971301 Predicted N-acetylglucosamine kinase [Carbohydrate tran 91.98
PRK09557301 fructokinase; Reviewed 91.16
KOG0797 618 consensus 98.08
KOG0679426 consensus 98.06
pfam01869288 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family. This fam 97.78
pfam02782193 FGGY_C FGGY family of carbohydrate kinases, C-terminal 96.8
PRK10331470 L-fuculokinase; Provisional 96.72
PRK10640471 rhaB rhamnulokinase; Provisional 95.81
PRK00047498 glpK glycerol kinase; Provisional 97.54
PTZ00294510 glycerol kinase; Provisional 96.77
PRK10939521 autoinducer-2 (AI-2) kinase; Provisional 96.55
PRK04123542 ribulokinase; Provisional 95.84
KOG2531545 consensus 95.78
TIGR03123318 one_C_unchar_1 probable H4MPT-linked C1 transfer pathwa 95.3
KOG0677389 consensus 96.73
COG0554499 GlpK Glycerol kinase [Energy production and conversion] 94.58
TIGR01312 494 XylB xylulokinase; InterPro: IPR006000 The ability to m 96.17
COG0145 674 HyuA N-methylhydantoinase A/acetone carboxylase, beta s 95.77
KOG0678415 consensus 94.96
TIGR02627460 rhamnulo_kin rhamnulokinase; InterPro: IPR013449 Rhamnu 93.14
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA; InterPro: IPR003494 FtsA is essential for bacterial cell division, and co-localizes to the septal ring with FtsZ Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein; InterPro: IPR013366 Salmonella typhimurium is capable of growth on ethanolamine as a sole source of carbon nitrogen and energy Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK; InterPro: IPR012725 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA; InterPro: IPR010236 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM; InterPro: IPR005883 The opportunistic pathogen Pseudomonas aeruginosa produces type 4 fimbriae which promote adhesion to epithelial cells and are associated with a form of surface translocation called twitching motility Back     alignment and domain information
>KOG0104 consensus Back     alignment and domain information
>TIGR01312 XylB xylulokinase; InterPro: IPR006000 The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase; InterPro: IPR005999 Glycerol kinase (2 Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>pfam02491 FtsA Cell division protein FtsA Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>pfam06723 MreB_Mbl MreB/Mbl protein Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>pfam00012 HSP70 Hsp70 protein Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0100 consensus Back     alignment and domain information
>KOG0101 consensus Back     alignment and domain information
>KOG0103 consensus Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>PTZ00004 actin; Provisional Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>pfam06406 StbA StbA protein Back     alignment and domain information
>pfam08841 DDR Diol dehydratase reactivase ATPase-like domain Back     alignment and domain information
>pfam00022 Actin Actin Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>pfam02491 FtsA Cell division protein FtsA Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>pfam06277 EutA Ethanolamine utilisation protein EutA Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13319 consensus Back     alignment and domain information
>PRK13323 consensus Back     alignment and domain information
>pfam03702 UPF0075 Uncharacterized protein family (UPF0075) Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>KOG0102 consensus Back     alignment and domain information
>PTZ00280 actin; Provisional Back     alignment and domain information
>KOG0676 consensus Back     alignment and domain information
>pfam11104 Competence_A Competence protein A Back     alignment and domain information
>TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit Back     alignment and domain information
>COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information
>pfam01968 Hydantoinase_A Hydantoinase/oxoprolinase Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative; InterPro: IPR008275 This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from Methanococcus jannaschii and Methanobacterium thermoautotrophicum that share an additonal N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterised protein of Aquifex aeolicus Back     alignment and domain information
>PRK13317 pantothenate kinase; Provisional Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02541 Ppx-GppA Ppx/GppA phosphatase family Back     alignment and domain information
>KOG0680 consensus Back     alignment and domain information
>KOG0681 consensus Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>PRK13334 consensus Back     alignment and domain information
>pfam07520 SrfB Virulence factor SrfB Back     alignment and domain information
>COG4457 SrfB Uncharacterized protein conserved in bacteria, putative virulence factor [Function unknown] Back     alignment and domain information
>KOG0681 consensus Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase; InterPro: IPR013450 Proteins in this entry are L-fuculokinases from the clade that includes the Escherichia coli enzyme P11553 from SWISSPROT Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>pfam00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>KOG0797 consensus Back     alignment and domain information
>KOG0679 consensus Back     alignment and domain information
>pfam01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family Back     alignment and domain information
>pfam02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK10640 rhaB rhamnulokinase; Provisional Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase; Provisional Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>KOG2531 consensus Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>KOG0677 consensus Back     alignment and domain information
>COG0554 GlpK Glycerol kinase [Energy production and conversion] Back     alignment and domain information
>TIGR01312 XylB xylulokinase; InterPro: IPR006000 The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway Back     alignment and domain information
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0678 consensus Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase; InterPro: IPR013449 Rhamnulokinase (2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target440 cell division protein [Candidatus Liberibacter asiaticu
1e4f_T419 Ftsa (Apo Form) From Thermotoga Maritima Length = 4 3e-37
1e4g_T419 Ftsa (Atp-Bound Form) From Thermotoga Maritima Leng 4e-36
2ych_A377 Pilm-Piln Type Iv Pilus Biogenesis Complex Length = 3e-11
3kvg_A400 Crystal Structure Of The N-Terminal Domain Of Hsp70 1e-10
1dkg_D383 Crystal Structure Of The Nucleotide Exchange Factor 5e-20
2kho_A 605 Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP 6e-20
2v7y_A 509 Crystal Structure Of The Molecular Chaperone Dnak F 5e-14
3ldl_A384 Crystal Structure Of Human Grp78 (70kda Heat Shock 1e-12
3iuc_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-12
3gdq_A408 Crystal Structure Of The Human 70kda Heat Shock Pro 6e-12
1qqn_A378 D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 3e-11
3i33_A404 Crystal Structure Of The Human 70kda Heat Shock Pro 1e-10
3cqx_A386 Chaperone Complex Length = 386 1e-10
2qwn_A394 Crystal Structure Of Disulfide-Bond-Crosslinked Com 2e-10
1qqo_A378 E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 2e-10
1kaz_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71e 2e-10
2v7z_A 543 Crystal Structure Of The 70-Kda Heat Shock Cognate 2e-10
3fe1_A403 Crystal Structure Of The Human 70kda Heat Shock Pro 2e-10
1hjo_A380 Heat-Shock 70kd Protein 42kd Atpase N-Terminal Doma 2e-10
3d2f_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 2e-10
1ngb_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 2e-10
3a8y_A392 Crystal Structure Of The Complex Between The Bag5 B 3e-10
2e8a_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 3e-10
2e88_A391 Crystal Structure Of The Human Hsp70 Atpase Domain 3e-10
3jxu_A409 Crystal Structure Of The Human 70kda Heat Shock Pro 3e-10
1nga_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-10
1qqm_A378 D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro 3e-10
1hx1_A400 Crystal Structure Of A Bag Domain In Complex With T 3e-10
3fzf_A381 Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP 3e-10
2qw9_B394 Crystal Structure Of Bovine Hsc70 (1-394aa)in The A 3e-10
1atr_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 4e-10
1ngf_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-10
1ngc_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-10
1ngd_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-10
1hpm_A386 How Potassium Affects The Activity Of The Molecular 5e-10
3c7n_B 554 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 5e-10
1nge_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 5e-10
1ba0_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 5e-10
1ats_A386 Threonine 204 Of The Chaperone Protein Hsc70 Influe 6e-10
1yuw_A 554 Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 7e-10
3d2e_B382 Crystal Structure Of A Complex Of Sse1p And Hsp70, 8e-10
1s3x_A382 The Crystal Structure Of The Human Hsp70 Atpase Dom 8e-10
1bup_A386 T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot 9e-10
1ba1_A386 Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi 9e-10
1kay_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71a 2e-09
1kax_A381 70kd Heat Shock Cognate Protein Atpase Domain, K71m 2e-09
3c7n_A 668 Structure Of The Hsp110:hsc70 Nucleotide Exchange C 4e-09
2qxl_A 658 Crystal Structure Analysis Of Sse1, A Yeast Hsp110 4e-09
3d2f_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70 L 5e-09
1ngh_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 1e-08
3d2e_A 675 Crystal Structure Of A Complex Of Sse1p And Hsp70, 1e-08
2bup_A381 T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 1e-08
1ngg_A386 Structural Basis Of The 70-Kilodalton Heat Shock Co 3e-08
3gl1_A387 Crystal Structure Of Atpase Domain Of Ssb1 Chaperon 4e-06
1jcf_A344 Mreb From Thermotoga Maritima, Trigonal Length = 34 7e-08
1jce_A344 Mreb From Thermotoga Maritima Length = 344 3e-07
>gi|11514422|pdb|1E4G|T Chain T, Ftsa (Atp-Bound Form) From Thermotoga Maritima Length = 419 Back     alignment and structure
>gi|332639533|pdb|2YCH|A Chain A, Pilm-Piln Type Iv Pilus Biogenesis Complex Length = 377 Back     alignment and structure
>gi|284055739|pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 Back     alignment and structure
>gi|2392283|pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 Back     alignment and structure
>gi|237640373|pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 Back     alignment and structure
>gi|178847298|pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 Back     alignment and structure
>gi|320089786|pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 Back     alignment and structure
>gi|259090349|pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 Back     alignment and structure
>gi|226887861|pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1- Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 Back     alignment and structure
>gi|6137548|pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>gi|254575046|pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 Back     alignment and structure
>gi|215261181|pdb|3CQX|A Chain A, Chaperone Complex Length = 386 Back     alignment and structure
>gi|163310915|pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa) D876c In The AdpPi State Length = 394 Back     alignment and structure
>gi|6137549|pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>gi|157831590|pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 Back     alignment and structure
>gi|178847300|pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 Back     alignment and structure
>gi|218681957|pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 Back     alignment and structure
>gi|6729803|pdb|1HJO|A Chain A, Heat-Shock 70kd Protein 42kd Atpase N-Terminal Domain Length = 380 Back     alignment and structure
>gi|190613723|pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 Back     alignment and structure
>gi|157832110|pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|292659561|pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 Back     alignment and structure
>gi|166007013|pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 Back     alignment and structure
>gi|166007012|pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 Back     alignment and structure
>gi|261825070|pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 Back     alignment and structure
>gi|157832109|pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|6137547|pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 Back     alignment and structure
>gi|13399491|pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 Back     alignment and structure
>gi|225698069|pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 Back     alignment and structure
>gi|163310910|pdb|2QW9|B Chain B, Crystal Structure Of Bovine Hsc70 (1-394aa)in The Apo State Length = 394 Back     alignment and structure
>gi|157830078|pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>gi|157832114|pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832111|pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157832112|pdb|1NGD|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157831370|pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 Back     alignment and structure
>gi|189096177|pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 Back     alignment and structure
>gi|157832113|pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 Back     alignment and structure
>gi|157830186|pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 Back     alignment and structure
>gi|157830079|pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 Back     alignment and structure
>gi|78101017|pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 Back     alignment and structure
>gi|190613719|pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine-Labeled Crystals Length = 382 Back     alignment and structure
>gi|42543698|pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 Back     alignment and structure
>gi|6729733|pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 Back     alignment and structure
>gi|157830187|pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 Back     alignment and structure