254781178

254781178

cell division protein

GeneID in NCBI database:8210203Locus tag:CLIBASIA_05425
Protein GI in NCBI database:254781178Protein Accession:YP_003065591.1
Gene range:-(1178005, 1178919)Protein Length:304aa
Gene description:cell division protein
COG prediction:[M] Cell division septal protein
KEGG prediction:ftsQ; cell division protein; K03589 cell division protein FtsQ
SEED prediction:Cell division protein ftsQ
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP6 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQELKRMR
ccccccccccHHHHEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHccccccccEEEcHHHHHHHHHccccccEEEEEEEcccEEEEEEEEccEEEEEEEccEEEEEccccEEEEcccccccccccEEEcccHHHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEccccEEEEccccHHHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEccHHHHHHHHHHHHccHHHHHHcc
cccccccccccccccccccccccccHccccHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHccccccEEccHHHHHHHHHHcccHHEEEEEEccccEEEEEEEEEEcEEEEcccccEEEEcccccEEccccccccccccccccccHHHHHHHHHHHHHcHcHcHHHHEEEEcccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHcc
mfalnhrglsiDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYgasigghtrKVIDIVDSFIGFSIEKVRiignvetpeadiihcldlntstslIFFDAIKIQKQLLALPWIAHAEIrrlypdtmeirlterhpyaiwqnnsalylidnngyVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNgiiiklpeekFDVAIAKILELQNKyqildrdisvidmrlpdrlsvrlttgsfidrrdiVDKRDQELKRMR
mfalnhrglsidrRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELqnkyqildrdisvidmrlpdrlsvrlttgsfidrrdivdkrdqelkrmr
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQELKRMR
*******************************EEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLT**********************
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKR********
*****HRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQEL****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQELKRMR
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQELKRMR
MFALNHRGLSIDRRLCLVIGMSLSLCCVLGLEEMRNFLNFCVFLEKVLPSYCGVILAIFFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQELKRMR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target304 cell division protein [Candidatus Liberibacter asiaticu
315122573307 cell division protein [Candidatus Liberibacter solanace 1 1e-110
222086438310 cell division protein [Agrobacterium radiobacter K84] L 1 4e-57
325293459310 Cell division protein ftsQ [Agrobacterium sp. H13-3] Le 1 7e-55
159185043317 cell division protein [Agrobacterium tumefaciens str. C 1 1e-54
209550168310 cell division protein FtsQ [Rhizobium leguminosarum bv. 1 3e-54
190892578307 cell division protein [Rhizobium etli CIAT 652] Length 1 4e-54
86358445317 cell division protein [Rhizobium etli CFN 42] Length = 1 5e-54
241205550310 cell division protein FtsQ [Rhizobium leguminosarum bv. 1 1e-52
116253041307 cell division protein FtsQ [Rhizobium leguminosarum bv. 1 2e-52
261752718311 polypeptide-transport-associated domain-containing prot 1 3e-52
>gi|315122573|ref|YP_004063062.1| cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 307 Back     alignment and organism information
 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/304 (62%), Positives = 242/304 (79%), Gaps = 2/304 (0%)

Query: 1   MFALNHRG-LSIDRRLCLVIGMSLSLCCV-LGLEEMRNFLNFCVFLEKVLPSYCGVILAI 58
           MFALNHR  L I+R+    +G+SLSLC + +    MRNFL FC FL K+ P Y G+++ I
Sbjct: 1   MFALNHRDFLVINRKFGFAVGVSLSLCFISMDWGGMRNFLIFCSFLGKIFPPYFGLMITI 60

Query: 59  FFFAIVGIYGASIGGHTRKVIDIVDSFIGFSIEKVRIIGNVETPEADIIHCLDLNTSTSL 118
            FFA VG+YG  IGGHT  V+D+ +SF GFSI+K+RIIGNVET E D+I  L+L+ S S+
Sbjct: 61  LFFATVGVYGVFIGGHTHSVVDMFNSFFGFSIDKIRIIGNVETSEGDVIRLLELDKSESV 120

Query: 119 IFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIWQNNSALYLIDNNGYVI 178
           + FD +KIQK LLALPWIAHAEI RLYPDT+EIRL ER PYAIWQ+N+ L LID NG VI
Sbjct: 121 LSFDGVKIQKNLLALPWIAHAEIHRLYPDTIEIRLIERDPYAIWQDNNNLSLIDKNGNVI 180

Query: 179 TAFNHVRFAYLPILIGENIYKAVRSFEVLSNIAGITKFVKAYNWIAERRWDLHLHNGIII 238
            A  + +F +LPILIG+N  K ++SFE L   +GI +FVKAYNW++ERRW+LHLHNGI I
Sbjct: 181 VAVKNTKFMHLPILIGKNANKEIKSFEKLLAFSGIAQFVKAYNWVSERRWNLHLHNGITI 240

Query: 239 KLPEEKFDVAIAKILELQNKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQ 298
           KLPEE  ++A++ +LELQ+KY+ILDRDISVIDMRLPDR+++RLTTGSFIDR++I+++R+Q
Sbjct: 241 KLPEEGLNIALSHLLELQDKYKILDRDISVIDMRLPDRMAIRLTTGSFIDRQEIIERRNQ 300

Query: 299 ELKR 302
           EL R
Sbjct: 301 ELSR 304


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086438|ref|YP_002544972.1| cell division protein [Agrobacterium radiobacter K84] Length = 310 Back     alignment and organism information
>gi|325293459|ref|YP_004279323.1| Cell division protein ftsQ [Agrobacterium sp. H13-3] Length = 310 Back     alignment and organism information
>gi|159185043|ref|NP_355053.2| cell division protein [Agrobacterium tumefaciens str. C58] Length = 317 Back     alignment and organism information
>gi|209550168|ref|YP_002282085.1| cell division protein FtsQ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 310 Back     alignment and organism information
>gi|190892578|ref|YP_001979120.1| cell division protein [Rhizobium etli CIAT 652] Length = 307 Back     alignment and organism information
>gi|86358445|ref|YP_470337.1| cell division protein [Rhizobium etli CFN 42] Length = 317 Back     alignment and organism information
>gi|241205550|ref|YP_002976646.1| cell division protein FtsQ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 310 Back     alignment and organism information
>gi|116253041|ref|YP_768879.1| cell division protein FtsQ [Rhizobium leguminosarum bv. viciae 3841] Length = 307 Back     alignment and organism information
>gi|261752718|ref|ZP_05996427.1| polypeptide-transport-associated domain-containing protein FtsQ-type [Brucella suis bv. 5 str. 513] Length = 311 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target304 cell division protein [Candidatus Liberibacter asiaticu
pfam03799115 pfam03799, FtsQ, Cell division protein FtsQ 8e-15
pfam0847867 pfam08478, POTRA_1, POTRA domain, FtsQ-type 8e-14
PRK05529255 PRK05529, PRK05529, cell division protein FtsQ; Provisi 2e-05
PRK10775276 PRK10775, PRK10775, cell division protein FtsQ; Provisi 3e-10
COG1589269 COG1589, FtsQ, Cell division septal protein [Cell envel 3e-32
>gnl|CDD|146439 pfam03799, FtsQ, Cell division protein FtsQ Back     alignment and domain information
>gnl|CDD|149506 pfam08478, POTRA_1, POTRA domain, FtsQ-type Back     alignment and domain information
>gnl|CDD|135428 PRK05529, PRK05529, cell division protein FtsQ; Provisional Back     alignment and domain information
>gnl|CDD|182720 PRK10775, PRK10775, cell division protein FtsQ; Provisional Back     alignment and domain information
>gnl|CDD|31777 COG1589, FtsQ, Cell division septal protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 304 cell division protein [Candidatus Liberibacter asiaticu
COG1589269 FtsQ Cell division septal protein [Cell envelope biogen 100.0
PRK10775274 cell division protein FtsQ; Provisional 100.0
PRK05529255 cell division protein FtsQ; Provisional 99.97
pfam03799115 FtsQ Cell division protein FtsQ. FtsQ is one of several 99.64
pfam0847867 POTRA_1 POTRA domain, FtsQ-type. FtsQ/DivIB bacterial d 99.6
COG4775 766 Outer membrane protein/protective antigen OMA87 [Cell e 98.18
PRK11067 801 outer membrane protein assembly factor YaeT; Provisiona 97.96
TIGR03303 741 OM_YaeT outer membrane protein assembly complex, YaeT p 97.65
PRK11067 801 outer membrane protein assembly factor YaeT; Provisiona 95.91
TIGR03303 741 OM_YaeT outer membrane protein assembly complex, YaeT p 95.37
pfam0847976 POTRA_2 POTRA domain, ShlB-type. The POTRA domain (for 94.08
pfam0724478 Surf_Ag_VNR Surface antigen variable number repeat. Thi 93.87
COG4775 766 Outer membrane protein/protective antigen OMA87 [Cell e 92.83
pfam06898383 YqfD Putative stage IV sporulation protein YqfD. This f 96.93
>COG1589 FtsQ Cell division septal protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10775 cell division protein FtsQ; Provisional Back     alignment and domain information
>PRK05529 cell division protein FtsQ; Provisional Back     alignment and domain information
>pfam03799 FtsQ Cell division protein FtsQ Back     alignment and domain information
>pfam08478 POTRA_1 POTRA domain, FtsQ-type Back     alignment and domain information
>COG4775 Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11067 outer membrane protein assembly factor YaeT; Provisional Back     alignment and domain information
>TIGR03303 OM_YaeT outer membrane protein assembly complex, YaeT protein Back     alignment and domain information
>PRK11067 outer membrane protein assembly factor YaeT; Provisional Back     alignment and domain information
>TIGR03303 OM_YaeT outer membrane protein assembly complex, YaeT protein Back     alignment and domain information
>pfam08479 POTRA_2 POTRA domain, ShlB-type Back     alignment and domain information
>pfam07244 Surf_Ag_VNR Surface antigen variable number repeat Back     alignment and domain information
>COG4775 Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam06898 YqfD Putative stage IV sporulation protein YqfD Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target304 cell division protein [Candidatus Liberibacter asiaticu
2vh2_A255 Crystal Structure Of Cell Divison Protein Ftsq From 5e-26
2vh1_A220 Crystal Structure Of Bacterial Cell Division Protei 1e-25
>gi|169791721|pdb|2VH2|A Chain A, Crystal Structure Of Cell Divison Protein Ftsq From Yersinia Enterecolitica Length = 255 Back     alignment and structure
 Score =  122 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/198 (21%), Positives = 80/198 (40%), Gaps = 4/198 (2%)

Query: 90  IEKVRIIG-NVETPEADIIHC-LDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPD 147
           + K+ + G    T   DI    L L    + +  D   IQ+Q+  LPWI  A +R+ +PD
Sbjct: 28  LSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPD 87

Query: 148 TMEIRLTERHPYAIWQNNSALYLIDNNGYVITAFNHVRFAYLPILIGENIYKAVRSFEVL 207
            ++I L E  P+A W +   +     +  V +     +   L      +    +  +  +
Sbjct: 88  ELKIHLVEYVPFARWNDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAI 147

Query: 208 SN-IAGITKFVKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNK-YQILDRD 265
           +  +A     +K     A   W L L N + ++L  +     + + +EL     Q  D+ 
Sbjct: 148 NKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQQPDKR 207

Query: 266 ISVIDMRLPDRLSVRLTT 283
           +S +D+R     ++    
Sbjct: 208 VSYVDLRYETGAAIGWAP 225


>gi|169791719|pdb|2VH1|A Chain A, Crystal Structure Of Bacterial Cell Division Protein Ftsq From E.Coli Length = 220 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target304 cell division protein [Candidatus Liberibacter asiaticu
2vh2_A255 FTSQ, cell division protein FTSQ; potra, cell cycle; 3. 6e-29
2vh1_A220 FTSQ, cell division protein FTSQ; potra, membrane, sept 2e-26
>2vh2_A FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Length = 255 Back     alignment and structure
 Score =  123 bits (309), Expect = 6e-29
 Identities = 46/202 (22%), Positives = 87/202 (43%), Gaps = 10/202 (4%)

Query: 88  FSIEKVRIIGNVE-TPEADIIHCL-DLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLY 145
             + K+ + G    T   DI   +  L    + +  D   IQ+Q+  LPWI  A +R+ +
Sbjct: 26  LPLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQW 85

Query: 146 PDTMEIRLTERHPYAIWQNNSALYLIDNNGYVIT-AFNHVRFAYLPILIG--ENIYKAVR 202
           PD ++I L E  P+A W +    +++D  G   +     V    LP+L G   +    + 
Sbjct: 86  PDELKIHLVEYVPFARWNDL---HMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLE 142

Query: 203 SFEVLSNIAGITKF-VKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNK-YQ 260
            +  ++ +    K+ +K     A   W L L N + ++L  +     + + +EL     Q
Sbjct: 143 GYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQ 202

Query: 261 ILDRDISVIDMRLPDRLSVRLT 282
             D+ +S +D+R     ++   
Sbjct: 203 QPDKRVSYVDLRYETGAAIGWA 224


>2vh1_A FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Length = 220 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target304 cell division protein [Candidatus Liberibacter asiaticu
2vh2_A255 FTSQ, cell division protein FTSQ; potra, cell cycle; 3. 100.0
2vh1_A220 FTSQ, cell division protein FTSQ; potra, membrane, sept 100.0
1yr1_A119 Divib, FTSQ, cell-division initiation protein; divisome 98.3
2qdf_A 335 OMP85, outer membrane protein assembly factor YAET; pot 97.87
3efc_A 395 OMP85, outer membrane protein assembly factor YAET; pot 97.84
2x8x_X235 TLR1789 protein, OMP85; chaperone, TOC75, protein targe 94.18
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 93.14
3og5_A166 Outer membrane protein assembly complex, YAET Pro; potr 96.08
>2vh2_A FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Back     alignment and structure
Probab=100.00  E-value=2e-37  Score=256.96  Aligned_cols=206  Identities=23%  Similarity=0.389  Sum_probs=172.6

Q ss_pred             HCCEEEEEEEEECC-CCCCHHHHHHH-HCCCCCCCEEEECHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEEEEEEEEE
Q ss_conf             10812548999776-54898899998-08888984388759999999871976227999982898199999930379999
Q gi|254781178|r   85 FIGFSIEKVRIIGN-VETPEADIIHC-LDLNTSTSLIFFDAIKIQKQLLALPWIAHAEIRRLYPDTMEIRLTERHPYAIW  162 (304)
Q Consensus        85 ~~gF~I~~I~V~Gn-~~ls~~eIl~~-l~i~~~~sl~~ld~~~i~~~L~~~pwIk~a~V~r~~P~tL~I~I~Er~PvA~~  162 (304)
                      ...|+|++|.|+|| .++++++|.++ .++..+.|+|.+|+++++++|+++|||++|+|+|.||++|.|+|+||+|+|+|
T Consensus        23 ~~~l~I~~V~I~G~~~~~~~~~I~~al~~~~~~~ni~~ld~~~i~~~L~~~pwVk~a~V~R~~P~tL~I~V~Er~PvA~~  102 (255)
T 2vh2_A           23 SSRLPLSKLVVTGERHYTTNDDIRQAILSLGAPGTFMTQDVNIIQQQIERLPWIQQASVRKQWPDELKIHLVEYVPFARW  102 (255)
T ss_dssp             ----CCCEEEEESCCSSCCHHHHHHHHTTSCCSSTTTSCHHHHHHHHTSCCSSEEEEEEEEETTTEEEEEEEECCCCBBS
T ss_pred             CCCCCEEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEECHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEEEEEEEEE
T ss_conf             67773049999788601899999999862258996399879999999970898579999996799179999987766886


Q ss_pred             EECCEEEEEECCCCCCCC-CCCCCCCCCCCCCCCCHH--HHHHHHHHHHHH-HHHCCCEEEEEEECCCEEEEEECCCEEE
Q ss_conf             957927997056410321-000112454311377667--889999876640-1310330389982588058997498289
Q gi|254781178|r  163 QNNSALYLIDNNGYVITA-FNHVRFAYLPILIGENIY--KAVRSFEVLSNI-AGITKFVKAYNWIAERRWDLHLHNGIII  238 (304)
Q Consensus       163 ~~~g~~~~Id~~G~Vi~~-~~~~~~~~lPli~G~~~~--~~~~~~~~L~~~-~~l~~~i~~~~~v~~rrWdL~l~nGi~I  238 (304)
                         +..+++|.+|.+|.. .......++|++.|....  .....+..+... +....++.++.+.+.++|++.+++|+.|
T Consensus       103 ---~~~~~id~~G~vi~~~~~~~~~~~lp~i~g~~~~~~~~~~~~~~l~~~~~~~~~~i~~i~~~~~~~~~l~l~~g~~V  179 (255)
T 2vh2_A          103 ---NDLHMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAANKYQLKMVAMSARHSWQLALDNDVRL  179 (255)
T ss_dssp             ---SSSCEECTTCCEECCCSSTTCCSCCCEEECSTTCHHHHHHHHHHHHHHHHHTTCCCCEEECCTTCCEEEECSSSCCC
T ss_pred             ---CCCEEEECCCCEEECCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHCCHHHCCCEEEEECCCCEEEEEECCCEEE
T ss_conf             ---67268841684771263434334573662564208999999999975411121133058974697299994698499


Q ss_pred             EECCCCHHHHHHHHHHHHHHH-CHHCCCEEEEEEECCCEEEEEECCCCHHHHHHHH
Q ss_conf             808511799999999987630-1000883389611298369997684215589998
Q gi|254781178|r  239 KLPEEKFDVAIAKILELQNKY-QILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIV  293 (304)
Q Consensus       239 kLp~~~~~~~L~rL~~l~~~~-k~~~r~I~~IDLR~pdri~Vrl~~~a~~~r~~~~  293 (304)
                      +||.+++.+++++|.+++.+. +...+.|.||||||+|+++|+|++.+.++.....
T Consensus       180 ~lG~~~~~~kL~rl~~v~~~l~~~~~~~i~~IDLRY~ng~av~~~~~~~~~~~~~~  235 (255)
T 2vh2_A          180 ELGRDDRMGRLQRFIELYPMLQQQPDKRVSYVDLRYETGAAIGWAPVFIGSQGGEP  235 (255)
T ss_dssp             EEESSCCHHHHHHHHHSCSCCCC-CSCCEEEEECCSSSCCEEEECCCCC-------
T ss_pred             EECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEECCCCCCCCCCCCC
T ss_conf             97861499999999999999987525886299845799839965353566677888



>2vh1_A FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Back     alignment and structure
>1yr1_A Divib, FTSQ, cell-division initiation protein; divisome, cell cycle; NMR {Geobacillus stearothermophilus} PDB: 2alj_A Back     alignment and structure
>2qdf_A OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2x8x_X TLR1789 protein, OMP85; chaperone, TOC75, protein targeting; 1.97A {Thermosynechococcus elongatus} Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Back     alignment and structure
>3og5_A Outer membrane protein assembly complex, YAET Pro; potra fold, insertion of outer membrane proteins, protein BI; 2.69A {Escherichia coli} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 304 cell division protein [Candidatus Liberibacter asi
2vh2_A_98-255158 (A:98-255) FTSQ, cell division protein FTSQ; potra 7e-26
2vh1_A_72-220149 (A:72-220) FTSQ, cell division protein FTSQ; potra 7e-24
2vh2_A_1-9797 (A:1-97) FTSQ, cell division protein FTSQ; potra, 1e-10
2vh1_A_1-7171 (A:1-71) FTSQ, cell division protein FTSQ; potra, 2e-10
>2vh2_A (A:98-255) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica}Length = 158 Back     alignment and structure
 Score =  112 bits (281), Expect = 7e-26
 Identities = 26/149 (17%), Positives = 56/149 (37%), Gaps = 8/149 (5%)

Query: 158 PYAIWQNNSALYLIDNNGYVITA-FNHVRFAYLPILIGE--NIYKAVRSFEVLSNIAGIT 214
           P+A W +    +++D  G   +     V    LP+L G   +    +  +  ++ +    
Sbjct: 1   PFARWNDL---HMVDEQGRSFSVPSERVGKQKLPLLYGPEGSEQDVLEGYRAINKVLAAN 57

Query: 215 KF-VKAYNWIAERRWDLHLHNGIIIKLPEEKFDVAIAKILELQNKYQ-ILDRDISVIDMR 272
           K+ +K     A   W L L N + ++L  +     + + +EL    Q   D+ +S +D+R
Sbjct: 58  KYQLKMVAMSARHSWQLALDNDVRLELGRDDRMGRLQRFIELYPMLQQQPDKRVSYVDLR 117

Query: 273 LPDRLSVRLTTGSFIDRRDIVDKRDQELK 301
                ++         +        Q+  
Sbjct: 118 YETGAAIGWAPVFIGSQGGEPPVNGQQNS 146


>2vh1_A (A:72-220) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli}Length = 149 Back     alignment and structure
>2vh2_A (A:1-97) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica}Length = 97 Back     alignment and structure
>2vh1_A (A:1-71) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli}Length = 71 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target304 cell division protein [Candidatus Liberibacter asiaticu
2vh1_A_72-220149 FTSQ, cell division protein FTSQ; potra, membrane, 99.88
2vh2_A_98-255158 FTSQ, cell division protein FTSQ; potra, cell cycl 99.86
2vh2_A_1-9797 FTSQ, cell division protein FTSQ; potra, cell cycl 99.56
2vh1_A_1-7171 FTSQ, cell division protein FTSQ; potra, membrane, 99.51
2qdf_A_1-7575 OMP85, outer membrane protein assembly factor YAET 97.91
3efc_A_1-7373 OMP85, outer membrane protein assembly factor YAET 97.08
2qdf_A_249-33587 OMP85, outer membrane protein assembly factor YAET 93.29
3efc_A_248-395148 OMP85, outer membrane protein assembly factor YAET 93.22
2qdz_A_46-209164 TPSB transporter FHAC; beta barrel, potra domain, 90.5
1yr1_A_119 Divib, FTSQ, cell-division initiation protein; div 98.55
>2vh1_A (A:72-220) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Back     alignment and structure
Probab=99.88  E-value=3.4e-22  Score=160.87  Aligned_cols=139  Identities=22%  Similarity=0.298  Sum_probs=116.7

Q ss_pred             EEEEEEECCEEEEEECCCCCCC-CCCCCCCCCCCCCCCCCHH--HHHHHH-HHHHHHHHHCCCEEEEEEECCCEEEEEEC
Q ss_conf             7999995792799705641032-1000112454311377667--889999-87664013103303899825880589974
Q gi|254781178|r  158 PYAIWQNNSALYLIDNNGYVIT-AFNHVRFAYLPILIGENIY--KAVRSF-EVLSNIAGITKFVKAYNWIAERRWDLHLH  233 (304)
Q Consensus       158 PvA~~~~~g~~~~Id~~G~Vi~-~~~~~~~~~lPli~G~~~~--~~~~~~-~~L~~~~~l~~~i~~~~~v~~rrWdL~l~  233 (304)
                      |+|+|   ++.++||.+|.+|. +.+.....+||+++|.+.+  ...+.+ +.+...+++..++.++.+.++++|+++++
T Consensus         1 PvA~W---~~~~lid~~G~vf~~~~~~~~~~~LP~l~G~~~~~~~~l~~~~~~~~~l~~~~~~i~~l~~~~~~~w~l~l~   77 (149)
T 2vh1_A            1 PIARW---NDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLN   77 (149)
T ss_dssp             EEEEE---TTTEEEETTCCEEECCGGGTTTCCCCEEECSTTCHHHHHHHHHHHHHHHHTTTCCCCEEEECSSSCEEEECS
T ss_pred             EEEEE---CCCCCEECCCCEEECCCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEEEC
T ss_conf             68997---356638417988952644454246726427642089999999987643230124320247525873999978


Q ss_pred             CCEEEEECCCCHHHHHHHHHHHH----HHHCHHCCCEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             98289808511799999999987----6301000883389611298369997684215589998887987
Q gi|254781178|r  234 NGIIIKLPEEKFDVAIAKILELQ----NKYQILDRDISVIDMRLPDRLSVRLTTGSFIDRRDIVDKRDQE  299 (304)
Q Consensus       234 nGi~IkLp~~~~~~~L~rL~~l~----~~~k~~~r~I~~IDLR~pdri~Vrl~~~a~~~r~~~~~~r~k~  299 (304)
                      ||+.|+||++++.++|++|..++    ++.+...++|.+|||||||+++|+|+++++++..+...+++..
T Consensus        78 ~Gi~i~Lg~~~~~~rl~r~~~~~~~l~~~~~~~~~~i~~iDLRy~~g~aV~~~~~~~~~~~~~~~~~~~~  147 (149)
T 2vh1_A           78 NDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAE  147 (149)
T ss_dssp             SSCEEEEESSCHHHHHHHHHHHHHHHHHHHHHTTEEEEEEEEEETTEEEEEEEECC--------------
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCEEEECCCCCCCHHHCCCHHHHHH
T ss_conf             9818997874799999999999999998742035884399853899708977889910321201044553



>2vh2_A (A:98-255) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Back     alignment and structure
>2vh2_A (A:1-97) FTSQ, cell division protein FTSQ; potra, cell cycle; 3.4A {Yersinia enterocolitica} Back     alignment and structure
>2vh1_A (A:1-71) FTSQ, cell division protein FTSQ; potra, membrane, septation, cell cycle, transmembrane, inner membrane; 2.7A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:1-75) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:1-73) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdf_A (A:249-335) OMP85, outer membrane protein assembly factor YAET; potra domain, protein transport; 2.20A {Escherichia coli K12} PDB: 2qcz_A 2v9h_A Back     alignment and structure
>3efc_A (A:248-395) OMP85, outer membrane protein assembly factor YAET; potra fold, cell membrane, cell outer membrane; 3.30A {Escherichia coli} Back     alignment and structure
>2qdz_A (A:46-209) TPSB transporter FHAC; beta barrel, potra domain, membrane, protein transport; 3.15A {Bordetella pertussis} Back     alignment and structure
>1yr1_A (A:) Divib, FTSQ, cell-division initiation protein; divisome, cell cycle; NMR {Geobacillus stearothermophilus} PDB: 2alj_A Back     alignment and structure