254781179

254781179

D-alanine--D-alanine ligase

GeneID in NCBI database:8210204Locus tag:CLIBASIA_05430
Protein GI in NCBI database:254781179Protein Accession:YP_003065592.1
Gene range:-(1178907, 1179809)Protein Length:300aa
Gene description:D-alanine--D-alanine ligase
COG prediction:[M] D-alanine-D-alanine ligase and related ATP-grasp enzymes
KEGG prediction:ddl; D-alanine--D-alanine ligase (EC:6.3.2.4); K01921 D-alanine-D-alanine ligase [EC:6.3.2.4]
SEED prediction:D-alanine--D-alanine ligase (EC 6.3.2.4)
Pathway involved in KEGG:D-Alanine metabolism [PATH:las00473]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:Peptidoglycan Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
cEEEEcccHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHcccEEEcccHHHHHHHccHHHHHHHHHHcccccccEEEEccHHHHHHHHccccEEEEEccccccccEEEEccHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccEEEEEcccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccccEEEEEEEccccccccccHHHHHHHHccccHHHHHHHHHHHHHccc
EEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHcccccEEEEcccccccccHHHHHHHHHHcccEccccHHHHHHHHcHHHHHHHHHHccccEccEEEEEHcccccHHHccccEEEEEcccccccccEEEccHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEEccccccccEEEcccccEEccccEEcccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEccccccccccHHHHHHHHccccHHHHHHHHHHHHHHcc
mavlmggisserevSLSSGKACASALEdagfkvsqidvdRSVGLVLAhlkpdlafnvlhgnfgeDGLVQAILELLeipythsgILASALSMdkmrskqvvsscgvpvcpsilvnrftmdsqhlisppyvikplkggsslGIIVikkdqsipldllqssswnhgdQLLIEQYVDGIELTcgvmgdasldvteiavpksdfysyelkysslnsthvlpakiplDIYKEVQRLAFLAHQAigcrgisrsdflfdplsrkVFWLEinvqpgmtpvsifpEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQvvsscgvpvcpsILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASC**
************************ALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMD**********CGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR
MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGNFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target300 D-alanine--D-alanine ligase [Candidatus Liberibacter as
315122574311 D-alanine--D-alanine ligase [Candidatus Liberibacter so 1 1e-133
209550169308 D-alanine--D-alanine ligase [Rhizobium leguminosarum bv 1 1e-103
327194618337 D-alanine-D-alanine ligase protein [Rhizobium etli CNPA 1 1e-103
190892579308 D-alanine-D-alanine ligase [Rhizobium etli CIAT 652] Le 1 1e-103
86358446308 D-alanine--D-alanine ligase [Rhizobium etli CFN 42] Len 1 1e-102
222086439308 D-alanine-D-alanine ligase protein [Agrobacterium radio 1 1e-102
218674672308 D-alanine--D-alanine ligase [Rhizobium etli GR56] Lengt 1 1e-102
218462241308 D-alanine--D-alanine ligase [Rhizobium etli Kim 5] Leng 1 1e-102
218663185308 D-alanine--D-alanine ligase [Rhizobium etli IE4771] Len 1 1e-102
227822648306 D-alanine--D-alanine ligase [Sinorhizobium fredii NGR23 1 1e-101
>gi|315122574|ref|YP_004063063.1| D-alanine--D-alanine ligase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 311 Back     alignment and organism information
 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/300 (74%), Positives = 270/300 (90%)

Query: 1   MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHG 60
           + VLMGGISSER+VSL SG+ CA+ALED GFKV+ IDVDRS+GL+L+HLKPD+AFN LHG
Sbjct: 12  VVVLMGGISSERDVSLLSGRVCAAALEDWGFKVTSIDVDRSIGLILSHLKPDIAFNALHG 71

Query: 61  NFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDS 120
            FGEDGL+Q+ILE LEIPYTHSGILASALSMDKMR+K++VSS GV VCPS+LVNR TMDS
Sbjct: 72  GFGEDGLIQSILEFLEIPYTHSGILASALSMDKMRAKKIVSSSGVSVCPSVLVNRITMDS 131

Query: 121 QHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYVDGIELTCG 180
           QH++SPPY+IKPLKGGSSLG+IV+ + +S+PLD+LQSSSW HGDQLL+EQY++GIEL+CG
Sbjct: 132 QHVMSPPYIIKPLKGGSSLGVIVVTEGESVPLDVLQSSSWIHGDQLLVEQYINGIELSCG 191

Query: 181 VMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAFLAHQAIGC 240
           +MG+ +L VTEI   KSDFY+Y+ KYSS  S+HVLPA IP  I +EV+R++ +AHQAIGC
Sbjct: 192 IMGEQALSVTEIVSQKSDFYTYDSKYSSSVSSHVLPANIPWSILQEVRRISVVAHQAIGC 251

Query: 241 RGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWMVEDASCLR 300
           RGISRSDF+FDP+S+++FWLEIN QPGMT VSIFPEMAAYAGYSFR+LLLWM+EDASC R
Sbjct: 252 RGISRSDFIFDPVSKEIFWLEINTQPGMTNVSIFPEMAAYAGYSFRDLLLWMLEDASCSR 311


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550169|ref|YP_002282086.1| D-alanine--D-alanine ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 308 Back     alignment and organism information
>gi|327194618|gb|EGE61468.1| D-alanine-D-alanine ligase protein [Rhizobium etli CNPAF512] Length = 337 Back     alignment and organism information
>gi|190892579|ref|YP_001979121.1| D-alanine-D-alanine ligase [Rhizobium etli CIAT 652] Length = 308 Back     alignment and organism information
>gi|86358446|ref|YP_470338.1| D-alanine--D-alanine ligase [Rhizobium etli CFN 42] Length = 308 Back     alignment and organism information
>gi|222086439|ref|YP_002544973.1| D-alanine-D-alanine ligase protein [Agrobacterium radiobacter K84] Length = 308 Back     alignment and organism information
>gi|218674672|ref|ZP_03524341.1| D-alanine--D-alanine ligase [Rhizobium etli GR56] Length = 308 Back     alignment and organism information
>gi|218462241|ref|ZP_03502332.1| D-alanine--D-alanine ligase [Rhizobium etli Kim 5] Length = 308 Back     alignment and organism information
>gi|218663185|ref|ZP_03519115.1| D-alanine--D-alanine ligase [Rhizobium etli IE4771] Length = 308 Back     alignment and organism information
>gi|227822648|ref|YP_002826620.1| D-alanine--D-alanine ligase [Sinorhizobium fredii NGR234] Length = 306 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 D-alanine--D-alanine ligase [Candidatus Liberibacter as
PRK01372304 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed 1e-114
TIGR01205315 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase 4e-72
PRK01966333 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed 4e-64
PRK14571299 PRK14571, PRK14571, D-alanyl-alanine synthetase A; Prov 2e-48
PRK14572347 PRK14572, PRK14572, D-alanyl-alanine synthetase A; Prov 1e-42
PRK14569296 PRK14569, PRK14569, D-alanyl-alanine synthetase A; Prov 2e-39
PRK14568343 PRK14568, vanB, D-alanine--D-lactate ligase; Provisiona 5e-32
PRK14570364 PRK14570, PRK14570, D-alanyl-alanine synthetase A; Prov 1e-30
PRK14573809 PRK14573, PRK14573, bifunctional D-alanyl-alanine synth 5e-22
COG1181317 COG1181, DdlA, D-alanine-D-alanine ligase and related A 1e-73
pfam07478201 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-termin 2e-33
PRK12767326 PRK12767, PRK12767, carbamoyl phosphate synthase-like p 1e-05
pfam01820110 pfam01820, Dala_Dala_lig_N, D-ala D-ala ligase N-termin 1e-22
COG0458400 COG0458, CarB, Carbamoylphosphate synthase large subuni 3e-07
COG0439 449 COG0439, AccC, Biotin carboxylase [Lipid metabolism] 1e-05
TIGR02068 864 TIGR02068, cya_phycin_syn, cyanophycin synthetase 0.001
TIGR00877 423 TIGR00877, purD, phosphoribosylamine--glycine ligase 0.004
>gnl|CDD|179288 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>gnl|CDD|162248 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase Back     alignment and domain information
>gnl|CDD|179356 PRK01966, ddl, D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>gnl|CDD|184751 PRK14571, PRK14571, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|173036 PRK14572, PRK14572, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|173033 PRK14569, PRK14569, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|184750 PRK14568, vanB, D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>gnl|CDD|173034 PRK14570, PRK14570, D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>gnl|CDD|184752 PRK14573, PRK14573, bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|148851 pfam07478, Dala_Dala_lig_C, D-ala D-ala ligase C-terminus Back     alignment and domain information
>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|145141 pfam01820, Dala_Dala_lig_N, D-ala D-ala ligase N-terminus Back     alignment and domain information
>gnl|CDD|30806 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30788 COG0439, AccC, Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|162681 TIGR02068, cya_phycin_syn, cyanophycin synthetase Back     alignment and domain information
>gnl|CDD|162082 TIGR00877, purD, phosphoribosylamine--glycine ligase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 300 D-alanine--D-alanine ligase [Candidatus Liberibacter as
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 100.0
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 100.0
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 100.0
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 100.0
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 100.0
PRK02186 892 argininosuccinate lyase; Provisional 100.0
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 100.0
PRK08654 497 pyruvate carboxylase subunit A; Validated 100.0
PRK08462 446 biotin carboxylase; Validated 100.0
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 100.0
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 100.0
PRK05586 447 biotin carboxylase; Validated 99.97
TIGR00514 451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 99.97
PRK12833 458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 99.97
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 99.97
PRK08591 449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 99.97
PRK06111 449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 99.97
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 99.97
PRK12999 1147 pyruvate carboxylase; Reviewed 99.97
PRK07178 471 acetyl-CoA carboxylase; Validated 99.97
PRK07206415 hypothetical protein; Provisional 99.97
PRK08463 478 acetyl-CoA carboxylase; Validated 99.97
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 99.97
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 99.97
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 99.96
PRK10446300 ribosomal protein S6 modification protein; Provisional 99.96
KOG0238 670 consensus 99.95
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 99.95
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 99.95
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 99.95
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 99.93
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 99.92
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.91
PRK00885 424 phosphoribosylamine--glycine ligase; Provisional 99.89
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.88
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 99.88
KOG0369 1176 consensus 99.87
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877 459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.87
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 99.84
KOG0370 1435 consensus 99.8
PRK05784 485 phosphoribosylamine--glycine ligase; Provisional 99.79
KOG0370 1435 consensus 99.75
COG2232389 Predicted ATP-dependent carboligase related to biotin c 99.56
PRK05246316 glutathione synthetase; Provisional 99.48
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 99.05
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 99.02
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 98.96
TIGR01380322 glut_syn glutathione synthase; InterPro: IPR006284 Thes 98.31
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 100.0
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 99.98
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 99.97
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.94
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.85
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 99.83
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 99.83
pfam02955176 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp 99.44
TIGR02291320 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterP 99.36
TIGR01016 389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 98.91
pfam03133291 TTL Tubulin-tyrosine ligase family. Tubulins and microt 98.8
TIGR01435754 glu_cys_lig_rel putative glutamate--cysteine ligase/put 95.09
pfam07065297 D123 D123. This family contains a number of eukaryotic 94.57
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 99.97
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 99.96
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 99.94
PRK06849387 hypothetical protein; Provisional 99.89
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 99.88
COG0151 428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.85
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) 99.78
KOG0237 788 consensus 99.54
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 99.46
pfam05770307 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase 99.3
PRK06524 480 biotin carboxylase-like protein; Validated 99.05
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.94
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 99.91
COG3919415 Predicted ATP-grasp enzyme [General function prediction 99.63
PRK00696 388 sucC succinyl-CoA synthetase subunit beta; Provisional 98.33
COG0045 387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 98.27
pfam02750203 Synapsin_C Synapsin, ATP binding domain. Ca dependent A 97.72
KOG1057 1018 consensus 97.69
pfam01820110 Dala_Dala_lig_N D-ala D-ala ligase N-terminus. This fam 99.9
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 95.62
PRK09496 455 trkA potassium transporter peripheral membrane componen 91.44
TIGR02023 408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 91.04
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 90.84
pfam02514 1064 CobN-Mg_chel CobN/Magnesium Chelatase. This family cont 90.39
KOG0368 2196 consensus 99.84
KOG3895488 consensus 98.33
PRK12458349 glutathione synthetase; Provisional 99.12
pfam08442202 ATP-grasp_2 ATP-grasp domain. 98.22
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 93.02
KOG2156 662 consensus 97.41
KOG2157 497 consensus 96.85
pfam06849124 DUF1246 Protein of unknown function (DUF1246). This fam 94.92
PRK05693274 short chain dehydrogenase; Provisional 90.62
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758 Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>pfam03133 TTL Tubulin-tyrosine ligase family Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel putative glutamate--cysteine ligase/putative amino acid ligase; InterPro: IPR006335 This entry represents a family with an N-terminal region similar to proteobacterial glutamate-cysteine ligase (gamma-glutamylcysteine synthetase) Back     alignment and domain information
>pfam07065 D123 D123 Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>pfam02750 Synapsin_C Synapsin, ATP binding domain Back     alignment and domain information
>KOG1057 consensus Back     alignment and domain information
>pfam01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus Back     alignment and domain information
>pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 This entry represents a group of geranylgeranyl reductases specific for the biosyntheses of bacteriochlorophyll and chlorophyll Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam02514 CobN-Mg_chel CobN/Magnesium Chelatase Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>KOG3895 consensus Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>pfam08442 ATP-grasp_2 ATP-grasp domain Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2156 consensus Back     alignment and domain information
>KOG2157 consensus Back     alignment and domain information
>pfam06849 DUF1246 Protein of unknown function (DUF1246) Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target300 D-alanine--D-alanine ligase [Candidatus Liberibacter as
1iov_A306 Complex Of D-Ala:d-Ala Ligase With Adp And A Phosph 1e-47
1iow_A306 Complex Of Y216f D-Ala:d-Ala Ligase With Adp And A 1e-47
2i80_A360 Allosteric Inhibition Of Staphylococcus Aureus D-Al 8e-41
2i87_A364 Allosteric Inhibition Of Staphylococcus Aureus D-Al 8e-41
3n8d_A364 Crystal Structure Of Staphylococcus Aureus Vrsa-9 D 8e-41
1e4e_A343 D-Alanyl-D-Lacate Ligase Length = 343 8e-40
3i12_A364 The Crystal Structure Of The D-Alanyl-Alanine Synth 1e-39
1e4e_B343 D-Alanyl-D-Lacate Ligase Length = 343 2e-39
3rfc_A384 Crystal Structure Of D-Alanine-D-Alanine Ligase A F 2e-38
3e5n_A386 Crystal Strucutre Of D-Alanine-D-Alanine Ligase Fro 2e-38
3q1k_A367 The Crystal Structure Of The D-Alanyl-Alanine Synth 3e-38
3r23_A307 Crystal Structure Of D-Alanine--D-Alanine Ligase Fr 6e-37
3k3p_A383 Crystal Structure Of The Apo Form Of D-Alanine:d-Al 9e-35
3lwb_A373 Crystal Structure Of Apo D-Alanine:d-Alanine Ligase 3e-34
2fb9_A322 Crystal Structure Of The Apo Form Of D-Alanine: D-A 7e-31
2yzm_A319 Structure Of D-Alanine:d-Alanine Ligase With Substr 7e-31
2yzg_A319 Crystal Structure Of D-Ala:d-Ala Ligase From Thermu 1e-29
1ehi_A377 D-Alanine:d-Lactate Ligase (Lmddl2) Of Vancomycin-R 2e-25
2pvp_A367 Crystal Structure Of D-Alanine-D-Alanine Ligase Fro 1e-16
1jdb_B 1073 Carbamoyl Phosphate Synthetase From Escherichia Col 7e-10
1jdb_B 1073 Carbamoyl Phosphate Synthetase From Escherichia Col 1e-04
1a9x_A 1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 2e-09
1a9x_A 1073 Carbamoyl Phosphate Synthetase: Caught In The Act O 2e-04
1ce8_A 1073 Carbamoyl Phosphate Synthetase From Escherichis Col 2e-09
1ce8_A 1073 Carbamoyl Phosphate Synthetase From Escherichis Col 1e-04
2czg_A 433 Crystal Structure Of Probable Phosphoribosylglycina 8e-06
2vpq_A 451 Crystal Structure Of Biotin Carboxylase From S. Aur 2e-04
2qf7_A 1165 Crystal Structure Of A Complete Multifunctional Pyr 5e-04
1w96_A 554 Crystal Structure Of Biotin Carboxylase Domain Of A 0.002
1w93_A 553 Crystal Structure Of Biotin Carboxylase Domain Of A 0.002
2dzd_A 461 Crystal Structure Of The Biotin Carboxylase Domain 3e-04
3hbl_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 0.001
3hb9_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 0.001
3bg5_A 1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 0.001
3ho8_A 1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 0.001
3jzf_A 486 Crystal Structure Of Biotin Carboxylase From E. Col 0.003
2gpw_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 0.003
1bnc_A 449 Three-Dimensional Structure Of The Biotin Carboxyla 0.004
3g8d_A 444 Crystal Structure Of The Biotin Carboxylase Subunit 0.004
3g8c_A 444 Crystal Stucture Of Biotin Carboxylase In Complex W 0.004
2gps_A 469 Crystal Structure Of The Biotin Carboxylase Subunit 0.004
3n6r_A 681 Crystal Structure Of The Holoenzyme Of Propionyl-Co 7e-04
gi|157831485|pdb|1IOV|A Chain A, Complex Of D-Ala:d-Ala Ligase With Adp And A Phosphoryl Phosphonate Length = 306 Back     alignment and structure
 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 161/305 (52%), Gaps = 13/305 (4%)

Query: 1   MAVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHG 60
           +AVL+GG S+EREVSL+SG A  + L + G     +D        L  +     F  LHG
Sbjct: 5   IAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHG 64

Query: 61  NFGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDS 120
             GEDG +Q +LEL+ +PYT SG++ASALSMDK+RSK +    G+PV P + + R   + 
Sbjct: 65  RGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEK 124

Query: 121 ---------QHLISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQY 171
                       +  P ++KP + GSS+G+  +  + ++   L    ++ H +++LIE++
Sbjct: 125 GLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDAL--RLAFQHDEEVLIEKW 182

Query: 172 VDGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLA 231
           + G E T  ++G+  L       P   FY YE KY S  + +  PA +       +Q L 
Sbjct: 183 LSGPEFTVAILGEEILPSI-RIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQALV 241

Query: 232 FLAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLW 291
             A   +GC+G  R D + D    + + LE N  PGMT  S+ P  A  AG SF +L++ 
Sbjct: 242 LKAWTTLGCKGWGRIDVMLD-SDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR 300

Query: 292 MVEDA 296
           ++E A
Sbjct: 301 ILELA 305


>gi|157831486|pdb|1IOW|A Chain A, Complex Of Y216f D-Ala:d-Ala Ligase With Adp And A Phosphoryl Phosphinate Length = 306 Back     alignment and structure
>gi|116668041|pdb|2I80|A Chain A, Allosteric Inhibition Of Staphylococcus Aureus D-Alanine:d- Alanine Ligase Revealed By Crystallographic Studies Length = 360 Back     alignment and structure
>gi|116668048|pdb|2I87|A Chain A, Allosteric Inhibition Of Staphylococcus Aureus D-Alanine:d- Alanine Ligase Revealed By Crystallographic Studies Length = 364 Back     alignment and structure
>gi|308387880|pdb|3N8D|A Chain A, Crystal Structure Of Staphylococcus Aureus Vrsa-9 D-Ala:d-Ala Ligase Length = 364 Back     alignment and structure
>gi|14719503|pdb|1E4E|A Chain A, D-Alanyl-D-Lacate Ligase Length = 343 Back     alignment and structure
gi|256032847|pdb|3I12|A Chain A, The Crystal Structure Of The D-Alanyl-Alanine Synthetase A From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Str. Lt2 Length = 364 Back     alignment and structure
>gi|14719504|pdb|1E4E|B Chain B, D-Alanyl-D-Lacate Ligase Length = 343 Back     alignment and structure
>gi|332138295|pdb|3RFC|A Chain A, Crystal Structure Of D-Alanine-D-Alanine Ligase A From Xanthomonas Oryzae Pathovar Oryzae With Adp Length = 384 Back     alignment and structure
>gi|256032535|pdb|3E5N|A Chain A, Crystal Strucutre Of D-Alanine-D-Alanine Ligase From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 386 Back     alignment and structure
>gi|317455526|pdb|3Q1K|A Chain A, The Crystal Structure Of The D-Alanyl-Alanine Synthetase A From Salmonella Enterica Typhimurium Complexed With Adp Length = 367 Back     alignment and structure
>gi|327200743|pdb|3R23|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From Bacillus Anthracis Length = 307 Back     alignment and structure
>gi|306991644|pdb|3K3P|A Chain A, Crystal Structure Of The Apo Form Of D-Alanine:d-Alanine Ligase (Ddl) From Streptococcus Mutans Length = 383 Back     alignment and structure
gi|290790328|pdb|3LWB|A Chain A, Crystal Structure Of Apo D-Alanine:d-Alanine Ligase (Ddl) From Mycobacterium Tuberculosis Length = 373 Back     alignment and structure
>gi|114793805|pdb|2FB9|A Chain A, Crystal Structure Of The Apo Form Of D-Alanine: D-Alanine Ligase (Ddl) From Thermus Caldophilus: A Basis For The Substrate-Induced Conformational Changes Length = 322 Back     alignment and structure
gi|160286257|pdb|2YZM|A Chain A, Structure Of D-Alanine:d-Alanine Ligase With Substrate From Thermus Thermophilus Hb8 Length = 319 Back     alignment and structure
>gi|160286234|pdb|2YZG|A Chain A, Crystal Structure Of D-Ala:d-Ala Ligase From Thermus Thermophilus Hb8 Length = 319 Back     alignment and structure
>gi|8569477|pdb|1EHI|A Chain A, D-Alanine:d-Lactate Ligase (Lmddl2) Of Vancomycin-Resistant Leuconostoc Mesenteroides Length = 377 Back     alignment and structure
>gi|171848811|pdb|2PVP|A Chain A, Crystal Structure Of D-Alanine-D-Alanine Ligase From Helicobacter Pylori Length = 367 Back     alignment and structure
gi|3318817|pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 Back     alignment and structure
gi|3318817|pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 Back     alignment and structure
>gi|157838095|pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 Back     alignment and structure
>gi|157838095|pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 Back     alignment and structure
>gi|5821976|pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 Back     alignment and structure
>gi|5821976|pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 Back     alignment and structure
gi|88192722|pdb|2CZG|A Chain A, Crystal Structure Of Probable Phosphoribosylglycinamide Formyl Transferase (Ph0318) From Pyrococcus Horikoshii Ot3 Length = 433 Back     alignment and structure
gi|198443111|pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 Back     alignment and structure
>gi|158430175|pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>gi|60593826|pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 Back     alignment and structure
>gi|60593823|pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 Back     alignment and structure
>gi|158428180|pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 Back     alignment and structure
>gi|242556622|pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>gi|242556615|pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>gi|168988872|pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
gi|242556707|pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>gi|262368119|pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 Back     alignment and structure
>gi|110590389|pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
gi|1127198|pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 Back     alignment and structure
>gi|224510928|pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 Back     alignment and structure
>gi|224510926|pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 Back     alignment and structure
>gi|110590387|pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 Back     alignment and structure
gi|304445935|pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-Coa Carboxylase (Pcc) Length = 681 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 D-alanine--D-alanine ligase [Candidatus Liberibacter as
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphor 6e-66
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine l 7e-63
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synthetas 3e-62
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein VANA; 2e-58
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp 3e-58
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus 2e-45
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2.00A { 5e-45
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syntheta 2e-39
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} 3e-39
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosp 1e-36
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori 5e-33
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kinase, I 8e-30
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (II) IO 1e-18
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release, sch 1e-14
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pa 7e-08
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2e-09
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 1e-08
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, bio 2e-04
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amidotran 0.001
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin carboxyl 3e-07
3ouz_A 446 Biotin carboxylase; structural genomics, center for str 5e-07
3df7_A305 Putative ATP-grAsp superfamily protein; putative protei 8e-07
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, 3e-04
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondrial; P 0.003
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein compl 0.003
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* Length = 306 Back     alignment and structure
 Score =  246 bits (628), Expect = 6e-66
 Identities = 105/304 (34%), Positives = 160/304 (52%), Gaps = 13/304 (4%)

Query: 2   AVLMGGISSEREVSLSSGKACASALEDAGFKVSQIDVDRSVGLVLAHLKPDLAFNVLHGN 61
           AVL+GG S+EREVSL+SG A  + L + G     +D        L  +     F  LHG 
Sbjct: 6   AVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGR 65

Query: 62  FGEDGLVQAILELLEIPYTHSGILASALSMDKMRSKQVVSSCGVPVCPSILVNRFTMDSQ 121
            GEDG +Q +LEL+ +PYT SG++ASALSMDK+RSK +    G+PV P + + R   +  
Sbjct: 66  GGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRAEFEKG 125

Query: 122 HL---------ISPPYVIKPLKGGSSLGIIVIKKDQSIPLDLLQSSSWNHGDQLLIEQYV 172
                      +  P ++KP + GSS+G+  +  + +  L      ++ H +++LIE+++
Sbjct: 126 LSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENA--LQDALRLAFQHDEEVLIEKWL 183

Query: 173 DGIELTCGVMGDASLDVTEIAVPKSDFYSYELKYSSLNSTHVLPAKIPLDIYKEVQRLAF 232
            G E T  ++G+  L    I  P   FY YE K+ S  + +  PA +       +Q L  
Sbjct: 184 SGPEFTVAILGEEILPSIRI-QPSGTFYDYEAKFLSDETQYFCPAGLEASQEANLQALVL 242

Query: 233 LAHQAIGCRGISRSDFLFDPLSRKVFWLEINVQPGMTPVSIFPEMAAYAGYSFRELLLWM 292
            A   +GC+G  R D + D    + + LE N  PGMT  S+ P  A  AG SF +L++ +
Sbjct: 243 KAWTTLGCKGWGRIDVMLDS-DGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVRI 301

Query: 293 VEDA 296
           +E A
Sbjct: 302 LELA 305


>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase, RV2981C, structural genomics, TB structural genomics consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Length = 383 Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein VANA; ligase, cell WALL, antibiotic resistance, membrane, plasmid; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 Back     alignment and structure