peg_1140

peg_1140

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(1196738, 1197010)Protein Length:90aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
cccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccc
mtkrqedhYITREEFIEfctnsnskqdcLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
mtkrqedhyitREEFIefctnsnskQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
***********REEFIEFCTNSNSKQDCLISQFKLF**********VNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFK*
********YITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
******DHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWLFSALKNIAIAVTSLTAIIYGLLNIKGWFKQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target90
31712066590 hypothetical protein SC1_gp010 [Liberibacter phage SC1] 1 3e-45
31712070690 hypothetical protein SC2_gp010 [Liberibacter phage SC2] 1 2e-44
31712074990 hypothetical protein SC2_gp255 [Liberibacter phage SC2] 1 2e-42
31512192585 hypothetical protein CKC_00875 [Candidatus Liberibacter 1 3e-20
31512288785 hypothetical protein CKC_05715 [Candidatus Liberibacter 1 5e-15
31512230492 hypothetical protein CKC_02780 [Candidatus Liberibacter 1 1e-08
31512232055 hypothetical protein CKC_02860 [Candidatus Liberibacter 2 3e-10
>gi|317120665|gb|ADV02488.1| hypothetical protein SC1_gp010 [Liberibacter phage SC1] Length = 90 Back     alignment and organism information
 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/90 (98%), Positives = 90/90 (100%)

Query: 1  MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL 60
          MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL
Sbjct: 1  MTKRQEDHYITREEFIEFCTNSNSKQDCLISQFKLFEKHYREQQKGVNEILDILKSVKWL 60

Query: 61 FSALKNIAIAVTSLTAIIYGLLNIKGWFKQ 90
          FSALKNIAIAVTSLTAIIYG+LNIKGWFKQ
Sbjct: 61 FSALKNIAIAVTSLTAIIYGILNIKGWFKQ 90


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|317120706|gb|ADV02528.1| hypothetical protein SC2_gp010 [Liberibacter phage SC2] Length = 90 Back     alignment and organism information
>gi|317120749|gb|ADV02571.1| hypothetical protein SC2_gp255 [Liberibacter phage SC2] Length = 90 Back     alignment and organism information
>gi|315121925|ref|YP_004062414.1| hypothetical protein CKC_00875 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 85 Back     alignment and organism information
>gi|315122887|ref|YP_004063376.1| hypothetical protein CKC_05715 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 85 Back     alignment and organism information
>gi|315122304|ref|YP_004062793.1| hypothetical protein CKC_02780 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 92 Back     alignment and organism information
>gi|315122320|ref|YP_004062809.1| hypothetical protein CKC_02860 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 55 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00