254781202

254781202

hypothetical protein CLIBASIA_05545

GeneID in NCBI database:8210227Locus tag:CLIBASIA_05545
Protein GI in NCBI database:254781202Protein Accession:YP_003065615.1
Gene range:-(1199145, 1201739)Protein Length:864aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED
ccHHHHHHHHHHHcccccHHHHHHHHHHHHHEEEEcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHccHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHccccHHHHHHHHHHHHHHHcccHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHccccccEEEEcccHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHcccccccEEEEEEcccccccccccccEEEEEEEEEEHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc
ccHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccHHHHHHHHcHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHccHHHHcccccccHHHHHHcccccHHHHHHHHHHHHccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccEEEEEccccccHHHHccccHEccccccccHHHHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccc
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDrvqagvygkSQALFNKLFFkagsaevpLEMKIKAAETKVLSKFNEYaevgsknlgftldkqfgldvfdemkgkktqNEQASRLVKQYFETQRELHSQAHeagldykffenripqpmsvdklratkkddFVRSMLdwldlsrykdidgtplsrsEIASFVGEVFAErvrstsfkdpsipssevgvkrEFERVFHFKDSQAHMDYMEhfgvstnvNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSaagasmlgqhpigalledgfiSRQMlsrvgidkEAIQRINKMPLKERMELLSDVGLYAEGVVahgrnmmegsdafQIGHKLHSKMhkwsgaeyldkkrisSHALIVYNQIgrmtdtyaslkdlkadprldpSIKAFFKQLDDTDFTVIKRakamsspdgylyartpstiknlkdadlRDLARMSDKIAYHRKklknsktlspEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTsvrgamhtslfdrqrlglltykrgtRAGEALRMFQqftttptgmflnildlsnsakmpkgasMALNHVWIQYSATMALAGIGVASIKALlrgedpslpeviydgtlangallpYMDRLTKLVSKgdraaiggllgpvpsmVTNLTSSAVELAtkdnenskVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEelnpgyldrqqskKKKKGIELFQNmdeglphrlpfpfged
mkpeciqvlnkaagrelskkelrrledGIVRAyvsldgkglskAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAevgsknlgftLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQpmsvdklratkkDDFVrsmldwldlsrykdidgtplsrSEIASFVGEVFAErvrstsfkdpsipssevgvkreFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIAndqeasagnkvlkdwlgrNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFfkqlddtdfTVIKrakamsspdgylyartpstiknlkdadlrDLARMSDKIAYHRKklknsktlspeqRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAmhtslfdrqrlglLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGgllgpvpsMVTNLTSSAVElatkdnenskvnATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQnmdeglphrlpfpfged
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED
***ECIQ*LNKAAGR*LS*KELRRLEDGIVRAYVS**********RYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQAL************************KVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDE**************VKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKD****PLSRSEIASFVGEVFAER************************VFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTI***************************AMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQR*********MELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPG****************FQNMDEGLP**********
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLK***************QLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED
*KPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLP******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQxxxxxxxxxxxxxxxxxxxxxKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED
MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSLDGKGLSKAERYRLAGLKAEEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAGSAEVPLEMKIKAAETKVLSKFNEYAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQYFETQRELHSQAHEAGLDYKFFENRIPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDIDGTPLSRSEIASFVGEVFAERVRSTSFKDPSIPSSEVGVKREFERVFHFKDSQAHMDYMEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEASAGNKVLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGALLEDGFISRQMLSRVGIDKEAIQRINKMPLKERMELLSDVGLYAEGVVAHGRNMMEGSDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDLKADPRLDPSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYHRKKLKNSKTLSPEQRQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHTSLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHVWIQYSATMALAGIGVASIKALLRGEDPSLPEVIYDGTLANGALLPYMDRLTKLVSKGDRAAIGGLLGPVPSMVTNLTSSAVELATKDNENSKVNATKAIRKTLPFMNMWYLKNSFDHLILNQILEELNPGYLDRQQSKKKKKGIELFQNMDEGLPHRLPFPFGED

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target864 hypothetical protein CLIBASIA_05545 [Candidatus Liberib
309702799825 hypothetical phage protein [Escherichia coli ETEC H1040 1 7e-38
332344341824 conserved hypothetical protein [Escherichia coli UMNK88 1 5e-36
298381705824 conserved hypothetical protein [Escherichia coli FVEC13 1 1e-35
300898440824 conserved hypothetical protein [Escherichia coli MS 198 1 1e-35
331648163824 hypothetical protein ECIG_04089 [Escherichia coli M605] 1 1e-35
304398390921 hypothetical protein PanABDRAFT_3525 [Pantoea sp. aB] L 1 4e-30
85059173824 hypothetical protein SG1195 [Sodalis glossinidius str. 1 2e-29
330007168924 hypothetical protein HMPREF9538_03599 [Klebsiella sp. M 1 9e-29
30387396918 hypothetical protein epsilon15p17 [Enterobacteria phage 1 2e-28
215487808824 hypothetical protein E2348C_2741 [Escherichia coli O127 1 2e-27
>gi|309702799|emb|CBJ02130.1| hypothetical phage protein [Escherichia coli ETEC H10407] Length = 825 Back     alignment and organism information
 Score =  164 bits (415), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 209/874 (23%), Positives = 357/874 (40%), Gaps = 98/874 (11%)

Query: 1   MKPECIQVLNKAAGRELSKKELRRLEDGIVRAYVSL------DGKGLSKAERYRLAGLKA 54
           M+ ECIQ + +AA R L+ +E++ +ED I R   SL        + L+ AER R AG  A
Sbjct: 2   MRQECIQAVQQAAKRTLTAREIQDIEDRIYRNMRSLARDDPASWRQLTDAERLRRAGQLA 61

Query: 55  EEDFQKELIRSVNDAIDEAYKRHQLRSDLDRVQAGVYGKSQALFNKLFFKAG--SAEVPL 112
            ++ Q+E              R +L + ++  Q G  GK  AL   + F A   S  + +
Sbjct: 62  SDELQREAALKKRRVALTISARQRLDNFINNYQ-GADGKLGALNRTIAFSADGKSNFLSV 120

Query: 113 EMKIKAAETKVLSKFNE-YAEVGSKNLGFTLDKQFGLDVFDEMKGKKTQNEQASRLVKQY 171
           E + KA     LS+  E +  V  +  G   D+    D+  EM+G+ T N +A +  K +
Sbjct: 121 ESRTKATRDYALSQLQEAFEAVDPRFFGLFEDEAGVRDLVFEMRGQNTGNAKARKGAKAW 180

Query: 172 FETQRELHSQAHEAGLDYKFFENR-IPQPMSVDKLRATKKDDFVRSMLDWLDLSRYKDID 230
            E    L  + ++AG D  + EN  IPQ  S++K+ A  KD +V  ++  LD   Y   D
Sbjct: 181 GEVTELLRRRFNDAGGDIGYLENWGIPQHHSMEKVGAVTKDKWVSDVIGKLDRKYYTRSD 240

Query: 231 GTPLSRSEIASFVGEVFAERVRS--TSFKDPSIPSSEVGVKR-EFERVFHFKDSQAHMDY 287
           G  +S SE+ +F+GE +            D  +  S     R    R  HFKD+ +++ Y
Sbjct: 241 GQLMSDSELTAFLGEAYNTIATGGLNKLTDTGMRISGARANRGNASRQIHFKDADSYLQY 300

Query: 288 MEHFGVSTNVNTILTSELASLSKDIVIARELGPNADSFVKQMIVQTIANDQEA--SAGNK 345
            + +G   ++  I+   L  +SKDI +    GPN D   + ++ Q  A    A  S   K
Sbjct: 301 QQLYG-DRSLWEIMVGHLEGISKDIALVETYGPNPDHVFRSLLDQVKAETATANPSKTGK 359

Query: 346 VLKDWLGRNKLEVRQEAMLQMWEVMRYGETVENTGWANWMAGLRSAAGASMLGQHPIGAL 405
           V        +L    E +     +    + V N   A W   +R+   AS LG   + + 
Sbjct: 360 V-------ERLANNTENLYNF--ISGKTQPVANPHIARWSDNIRNWLVASRLGSALLSSF 410

Query: 406 LEDG--FISRQMLSRVGIDKEAIQRINKMPLKERME--LLSDVGLYAEGVVAHGRNMMEG 461
            + G  ++S + ++ + +++    ++  M    R E  L    GL  E ++         
Sbjct: 411 SDLGTMYLSAK-VTNLPMNQLFRNQLEAMDPTNRTELALARRAGLAMESLLGSVNRWAMD 469

Query: 462 SDAFQIGHKLHSKMHKWSGAEYLDKKRISSHALIVYNQIGRMTDTYASLKDL-KADPRLD 520
           +    +     + + + SG          ++ + +   +G +      L+ L  +D R+ 
Sbjct: 470 NMGPSVSRWAATAVMRASGLTAWSDAHKRAYGVTMMGSLGEVVSRTPDLRSLDDSDFRIL 529

Query: 521 PSIKAFFKQLDDTDFTVIKRAKAMSSPDGYLYARTPSTIKNLKDADLRDLARMSDKIAYH 580
            S     K + DTD++V K A+     +G     TP +I  + D+ ++ L          
Sbjct: 530 KS-----KGITDTDWSVWKLAQQEDWGNGNNTMLTPESIMRIPDSAVKHLG--------- 575

Query: 581 RKKLKNSKTLSPEQ-RQELQQQLADLERKEINILKDKVSNKMHALVLDNVQTSVRGAMHT 639
                      PE+ + E  ++L     +E+++       +    V   +Q         
Sbjct: 576 ----------EPERVKFEAMRKLLGAVTEEVDMAVITPGAREQMFVGSGLQ--------- 616

Query: 640 SLFDRQRLGLLTYKRGTRAGEALRMFQQFTTTPTGMFLNILDLSNSAKMPKGASMALNHV 699
                         RGT  GE  R    F + P  + +     S +  MP     A    
Sbjct: 617 --------------RGTWKGELTRSVFLFKSFPISVVMR--HWSRAMGMPSAGGRAAYIA 660

Query: 700 WIQYSATMALAGIGVAS--IKALLRGEDPS------LPEVIYDGTLANGALLPYMDRLTK 751
               S TM    +G  S  I  L+ G +P       + +   +  L  G    Y D L  
Sbjct: 661 TFLASTTM----LGALSMQITDLINGRNPKEMTGDHMVKFWINAFLKGGGAGLYGDFLFS 716

Query: 752 LVSKGDRAAIGGLLGPVPSMVTNLTSSA----VELATKDNENSKVNATKAIRKTLPFMNM 807
             ++    A+  +LGPV  +V ++   A    +      NE +  +  K  +  +P  N+
Sbjct: 717 DHTRYGSGALASMLGPVAGLVDDVVKIAQGIPLNAVEGKNEQTGGDLVKLGKGLMPGANL 776

Query: 808 WYLKNSFDHLILNQILEELNPGYLDRQQSKKKKK 841
           WYLK + DH+I NQ+ E  +PGYL + + + KK+
Sbjct: 777 WYLKAALDHMIFNQMQEYFSPGYLRKMEQRSKKE 810


Species: Escherichia coli
Genus: Escherichia
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332344341|gb|AEE57675.1| conserved hypothetical protein [Escherichia coli UMNK88] Length = 824 Back     alignment and organism information
>gi|298381705|ref|ZP_06991304.1| conserved hypothetical protein [Escherichia coli FVEC1302] Length = 824 Back     alignment and organism information
>gi|300898440|ref|ZP_07116781.1| conserved hypothetical protein [Escherichia coli MS 198-1] Length = 824 Back     alignment and organism information
>gi|331648163|ref|ZP_08349253.1| hypothetical protein ECIG_04089 [Escherichia coli M605] Length = 824 Back     alignment and organism information
>gi|304398390|ref|ZP_07380264.1| hypothetical protein PanABDRAFT_3525 [Pantoea sp. aB] Length = 921 Back     alignment and organism information
>gi|85059173|ref|YP_454875.1| hypothetical protein SG1195 [Sodalis glossinidius str. 'morsitans'] Length = 824 Back     alignment and organism information
>gi|330007168|ref|ZP_08305910.1| hypothetical protein HMPREF9538_03599 [Klebsiella sp. MS 92-3] Length = 924 Back     alignment and organism information
>gi|30387396|ref|NP_848225.1| hypothetical protein epsilon15p17 [Enterobacteria phage epsilon15] Length = 918 Back     alignment and organism information
>gi|215487808|ref|YP_002330239.1| hypothetical protein E2348C_2741 [Escherichia coli O127:H6 str. E2348/69] Length = 824 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target864 hypothetical protein CLIBASIA_05545 [Candidatus Liberib
PHA01972828 PHA01972, PHA01972, structural protein 1e-54
>gnl|CDD|177329 PHA01972, PHA01972, structural protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 864 hypothetical protein CLIBASIA_05545 [Candidatus Liberib
PHA01972828 structural protein 100.0
PHA003681316 internal virion protein D 98.01
PHA020061337 virion protein 97.92
>PHA01972 structural protein Back     alignment and domain information
>PHA00368 internal virion protein D Back     alignment and domain information
>PHA02006 virion protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00