255764517

255764517

hypothetical protein CLIBASIA_05538

GeneID in NCBI database:8303227Locus tag:CLIBASIA_05538
Protein GI in NCBI database:255764517Protein Accession:YP_003084345.1
Gene range:-(1198731, 1199138)Protein Length:135aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
ccEEccHHHccHHHcccEEEEEEccEEEEEEEcccHHHHHHHHcccccEEEEEEEcccccccccEEEEEEEcccccEEEEEEccHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc
cccEEcHHHcccccccEEEEEEEccEEEEEccccccccEEEEEEcccccEEEEEEEcccccccHHHHHEEccccccEEEEEccccccEEEcccccccccccHHHHcccccccccccccHEHHHcHHHHHHHHccc
MIRKVNMeklnfeqtksvtYWAVGskfvipwdikdpsrihaevgysdgrvQELAISQDFDVDGLNALLTvnnregdfirIFEGEkqtfkeynsdspraphnlvkeadlyplhnrldGVETIVSDLNNMKNRIQDL
mirkvnmeklnfeqtksvtywaVGSKFvipwdikdpsRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKeynsdspraphNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
*******EKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEV***********ISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKE***********LVKEADLYPLHNRLDGVETIVSDLNNM*******
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRI***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL
MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIVSDLNNMKNRIQDL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target135 hypothetical protein CLIBASIA_05538 [Candidatus Liberib
255764516 341 hypothetical protein CLIBASIA_05532 [Candidatus Li 2e-22
>gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment
 Score = 96.3 bits (238), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 10/123 (8%)

Query: 7   MEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFDVDGLNA 66
           M + NFEQ+K V+Y   GS FVIPW +KDPSRIHAEV Y DG ++EL+  +DF VD   +
Sbjct: 1   MMQYNFEQSKDVSYRLFGSYFVIPWTVKDPSRIHAEVKYPDGNMEELSPERDFKVDVDES 60

Query: 67  LLTVNNRE----GDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVETIV 122
            L ++++      + +RIFEGEKQTFK++N +  +      K   +  L  +++ ++ IV
Sbjct: 61  SLILSSKRWINNNNALRIFEGEKQTFKDFNIEVQK------KVNQVNVLTQKMNTIDGIV 114

Query: 123 SDL 125
           +DL
Sbjct: 115 NDL 117

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target135 hypothetical protein CLIBASIA_05538 [Candidatus Liberib
317120667 707 hypothetical protein SC1_gp025 [Liberibacter phage SC1] 1 1e-77
315122307176 hypothetical protein CKC_02795 [Candidatus Liberibacter 1 9e-21
317120708 280 hypothetical protein SC2_gp020 [Liberibacter phage SC2] 1 1e-18
255764516 341 hypothetical protein CLIBASIA_05532 [Candidatus Liberib 1 1e-18
31712075051 hypothetical protein SC2_gp260 [Liberibacter phage SC2] 1 1e-04
315121953 521 hypothetical protein CKC_01015 [Candidatus Liberibacter 1 0.002
>gi|317120667|gb|ADV02490.1| hypothetical protein SC1_gp025 [Liberibacter phage SC1] Length = 707 Back     alignment and organism information
 Score =  292 bits (748), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 134/135 (99%), Positives = 135/135 (100%)

Query: 1   MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD 60
           MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD
Sbjct: 1   MIRKVNMEKLNFEQTKSVTYWAVGSKFVIPWDIKDPSRIHAEVGYSDGRVQELAISQDFD 60

Query: 61  VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET 120
           VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET
Sbjct: 61  VDGLNALLTVNNREGDFIRIFEGEKQTFKEYNSDSPRAPHNLVKEADLYPLHNRLDGVET 120

Query: 121 IVSDLNNMKNRIQDL 135
           IVSDLNNMKNRIQ+L
Sbjct: 121 IVSDLNNMKNRIQEL 135


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315122307|ref|YP_004062796.1| hypothetical protein CKC_02795 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 176 Back     alignment and organism information
>gi|317120708|gb|ADV02530.1| hypothetical protein SC2_gp020 [Liberibacter phage SC2] Length = 280 Back     alignment and organism information
>gi|255764516|ref|YP_003084344.1| hypothetical protein CLIBASIA_05532 [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment and organism information
>gi|317120750|gb|ADV02572.1| hypothetical protein SC2_gp260 [Liberibacter phage SC2] Length = 51 Back     alignment and organism information
>gi|315121953|ref|YP_004062442.1| hypothetical protein CKC_01015 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 521 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00