254781203

254781203

hypothetical protein CLIBASIA_05550

GeneID in NCBI database:8210228Locus tag:CLIBASIA_05550
Protein GI in NCBI database:254781203Protein Accession:YP_003065616.1
Gene range:-(1201736, 1203172)Protein Length:478aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MYFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
cccccccHHHHHHHHHHHHHcccccccccccccccHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccEEcccHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHccccccHHHccccHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccccccccHHHHHHHHHHHccccccccccEcccccHEEEcccccccccccHHHHHHHcHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHccccccHHHHHccccccHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcccccHccccccEEEEcccccccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHcHHHHHccccccccccccccccccccccccccccccccccEcccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccc
myfnavsdeDIRDNIKEwaqrprvspdikwhtglgkevinmparsldklvapfreethdqpnyyrgsrtdphsvgtgAHLVEGLTSLAPYIAGAALAGKllsfiptpltrLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTsallapgaiasqSIAKTVASGavlnvpfgmvergwsskvledhgypdmaqhYRIFDMESLITDGLigaffggmhskQVQNMSLRLVNDLKEgiterlpykhgvkssspglhtsfdayEAHTDTLAHGvdslvrgeyphfdqekLQTIadntledphfkphlpepeplpqykehsdrqkpseplaehphpkrkEVERELSEIEgakkessarkffdegspdhspfkgernqkldpmrgadftdaphakfdattfteslphvdEQTMHRFSElkerhpveAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
myfnavsdedirdnikewaqrprvspdikwhtglgkevinmpARSLDKLVAPFREEthdqpnyyrgsrtdpHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGIterlpykhgvkssspGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPseplaehphpkrkeVERELSEiegakkessarkffdegspdhspfkgernqkldPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLqeklqgtkeiktksliKEAIncflrtggsl
MYFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSaplaagalyaylSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
****A**DE********************WHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKA*****HQ*EGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMH****************EGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGV*************************************************************************************************************************ATTFTESLPHVDEQTMHRF************************************AINCFLRTGG**
********EDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLP******************************SEIEGAKKESSARKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
*YFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYK**VKSSS*GLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLP*YK******************************************************************ADFTD*PHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKxxxxxxxxxxxxxxxxxxxxxKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
MYFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL
MYFNAVSDEDIRDNIKEWAQRPRVSPDIKWHTGLGKEVINMPARSLDKLVAPFREETHDQPNYYRGSRTDPHSVGTGAHLVEGLTSLAPYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDKETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGYPDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKSSSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADNTLEDPHFKPHLPEPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELSEIEGAKKESSARKFFDEGSPDHSPFKGERNQKLDPMRGADFTDAPHAKFDATTFTESLPHVDEQTMHRFSELKERHPVEAREVLEGLQEKLQGTKEIKTKSLIKEAINCFLRTGGSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target478 hypothetical protein CLIBASIA_05550 [Candidatus Liberib
332160978430 hypothetical protein YE105_C1356 [Yersinia enterocoliti 1 1e-14
30387395 634 hypothetical protein epsilon15p16 [Enterobacteria phage 1 3e-14
301028421 686 conserved domain protein [Escherichia coli MS 196-1] Le 1 4e-14
304398391 625 hypothetical protein PanABDRAFT_3526 [Pantoea sp. aB] L 1 5e-11
330007167 632 hypothetical protein HMPREF9538_03598 [Klebsiella sp. M 1 1e-10
317120710408 hypothetical protein SC2_gp040 [Liberibacter phage SC2] 1 8e-10
268589386594 conserved hypothetical protein [Providencia rettgeri DS 1 1e-08
315122889363 hypothetical protein CKC_05725 [Candidatus Liberibacter 1 2e-08
315121927326 hypothetical protein CKC_00885 [Candidatus Liberibacter 1 2e-08
309702800600 hypothetical phage protein [Escherichia coli ETEC H1040 1 1e-07
>gi|332160978|ref|YP_004297555.1| hypothetical protein YE105_C1356 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] Length = 430 Back     alignment and organism information
 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 127/277 (45%), Gaps = 12/277 (4%)

Query: 88  APYIAGAALAGKLLSFIPTPLTRLAGLALQSAPLAAGALYAYLSHKAESSIHHQIEGVDK 147
           AP       AG++L+ +   ++R  G  + + PL  GA+ A  +    ++     +G+D 
Sbjct: 101 APEATVTTTAGQILNGLGDVMSRAVGGTVAAGPLG-GAVLAGGTEAIFANDEGLRKGLDP 159

Query: 148 ETADALAWREAIVHTSALLAPGAIASQSIAKTVASGAVLNVPFGMVERGWSSKVLEDHGY 207
            TA      + +   +  L P A  ++++   VA+GA  N+  G V+RG +++ LE  GY
Sbjct: 160 LTAAGKGVLDGVSLGAGTLVPAAPFAKTLLSRVAAGAASNIAIGAVQRGTTAEWLEQRGY 219

Query: 208 PDMAQHYRIFDMESLITDGLIGAFFGGMHSKQVQNMSLRLVNDLKEGITERLPYKHGVKS 267
            DMAQ Y+++D  +++ DG++GA FGG+      ++      D  +        +H  + 
Sbjct: 220 KDMAQQYKVWDATAMLADGVLGAAFGGLA-----HIGAAATPDSVDAALTARNAQHFRED 274

Query: 268 SSPGLHTSFDAYEAHTDTLAHGVDSLVRGEYPHFDQEKLQTIADN---TLEDPHFKPHLP 324
           ++PG+ T   +  AH   L    D + RGE    D   +  + D      +  +F     
Sbjct: 275 TAPGIPTDIPSNIAHQRALETATDQINRGE--PVDVANIDGVFDAHFIARDGSNFAEQPA 332

Query: 325 EPEPLPQYKEHSDRQKPSEPLAEHPHPKRKEVERELS 361
           E  P P  +  +  Q P +  AE   P+   + R+++
Sbjct: 333 EIAPRPVAESEATFQ-PEKTTAETATPEADPILRDIN 368


Species: Yersinia enterocolitica
Genus: Yersinia
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|30387395|ref|NP_848224.1| hypothetical protein epsilon15p16 [Enterobacteria phage epsilon15] Length = 634 Back     alignment and organism information
>gi|301028421|ref|ZP_07191667.1| conserved domain protein [Escherichia coli MS 196-1] Length = 686 Back     alignment and organism information
>gi|304398391|ref|ZP_07380265.1| hypothetical protein PanABDRAFT_3526 [Pantoea sp. aB] Length = 625 Back     alignment and organism information
>gi|330007167|ref|ZP_08305909.1| hypothetical protein HMPREF9538_03598 [Klebsiella sp. MS 92-3] Length = 632 Back     alignment and organism information
>gi|317120710|gb|ADV02532.1| hypothetical protein SC2_gp040 [Liberibacter phage SC2] Length = 408 Back     alignment and organism information
>gi|268589386|ref|ZP_06123607.1| conserved hypothetical protein [Providencia rettgeri DSM 1131] Length = 594 Back     alignment and organism information
>gi|315122889|ref|YP_004063378.1| hypothetical protein CKC_05725 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 363 Back     alignment and organism information
>gi|315121927|ref|YP_004062416.1| hypothetical protein CKC_00885 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 326 Back     alignment and organism information
>gi|309702800|emb|CBJ02131.1| hypothetical phage protein [Escherichia coli ETEC H10407] Length = 600 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00