254781204

254781204

hypothetical protein CLIBASIA_05555

GeneID in NCBI database:8210229Locus tag:CLIBASIA_05555
Protein GI in NCBI database:254781204Protein Accession:YP_003065617.1
Gene range:-(1203190, 1205313)Protein Length:707aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP
cEEEccccccccEEcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcHHHcccHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccHHHHHHHHHHHHHHHHHHHccccccHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEccccccccHHcccccccccHHHHHHHHHHccHHHHHHHHcccccccccccEEEEEEEEccccccccEEEEEEEccEEEEEEcccccccccHHcccccccccccccHHEEEEEccccccccEEEEEEEccccEEEEEEcccccccccccEEEEEHHHccHHHHHHHHHHHHHHHHHHcccc
cEEEEcccccEEEEccccccHHccccccccHccHHHHHHHHHHHHHHHcHccHHHHcccccEEEcHHHHHcHcccccccccHHHHHccccHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEEcccHHHHHHcccHHHHHHHHHHHccccccHHHHHHHEccHHHccccccHHHHHHHHHHHHHHHcHcHHHcccccccHHHHHHHHHHHHcccccccccccccccccHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEEHHHHHHHHcccccHHHEccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHccccccHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEEcHHccccHHHHHHHHHHHHHccccccEEEccccccccccccccccccccccEEEcccccHHHcHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHcccccccccccccccccccHHHHcHHEEEEEcccccccccEEEEEEccccEEEEEEcccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccc
mieittnkplveavtpnqdavrdsvnpqaglRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFhdftnsldtrdslqagdkikeyvdGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRdyhtkgvdiqigatqraqedNLNMTVGLAAAHvlhdpsnenYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLntnqiigahardprVFENFMRAfykkghppkdstslsdvsdsaRERSLEVVEDVSKAIGlagwdrldDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQlnhgitvkpselipledytqaygveqgtelynlqqfksvaapdvARIKLMSTFDAKKFLQKIDdeyisnpslsLASTMMATKYKEILEKSHRQSMQELNQDAISWGikykqidplrfdteeSFADSLRQRAGFVKkikddynlttshfnkteENQLRTQlvkrpasesvDLIRGAYntlsdsdkegvrssfahiEDNGLSAVVRLSSEFSDDAKNAAMVILSGmkhqkdtetryntdhksnkfdslydsyintpltkleqstaggnfnkdKEAIKLYLLGSmkdsgnytlnrvrVSDAMQIVlgntpvninesmlmpprgmsktdfeDRLWyatkdtgeydpytikymnvgsgkymiikngnpkvdkegkTIIINvedvnrderMESTIRHYEHqifnehap
mieittnkplveavtpnqdavrdSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTnsldtrdslqagdkikeyvdgriRSAYDrflssishrdvRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEklntnqiigahardprVFENFMRAFYKkghppkdstslsdvsDSARERSLEvvedvskaiglagwdrlddtKRRRLLehlssrdnalntklrkETQAQARRIDaqlnhgitvkpselipLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLttshfnkteenqlrtqlvkrpasesvdLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGmkhqkdtetryntdhksnkfDSLYDSYINTPLTKleqstaggnfnKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGntpvninesmlmppRGMSKTDFEDRLWYatkdtgeydpyTIKYMNVGSGKYMIIKngnpkvdkegktiiinvedvnrdeRMESTIrhyehqifnehap
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLAGWdrlddtkrrrllEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP
*******KP**************************DALGKAT**********AFATANTRYTELSFKAVQDFHDFT************************SAYDRFLSSISHRDV*****************************************AAAHVLH************S*TDHINSLPIDLRLKQKLLSEAKEKLNTNQ*****ARDPRVF***************************************KAIGLAGWDRLDDTKRRR***************************DAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMS************************STMMATKYKEILEKSHRQ*M**LNQDAISWGIKYKQIDPLRFDTEESFADSLRQRA***K******NLT***F****************ASESVDLIRG****************FAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKD*******DHKSNKFDSLYDSYINTPLTKLEQS******NKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQI******
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKG***********************VEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGH******************SLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP
MIEITTNKPLVEAVTPNQDAVRDSVNPQAGLRDLGDALGKATQFLEGIRRDNAFATANTRYTELSFKAVQDFHDFTNSLDTRDSLQAGDKIKEYVDGRIRSAYDRFLSSISHRDVRKKFQAQVEHDIRDYHTKGVDIQIGATQRAQEDNLNMTVGLAAAHVLHDPSNENYFQRVQSITDHINSLPIDLRLKQKLLSEAKEKLNTNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLAGWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRIDAQLNHGITVKPSELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNPSLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEESFADSLRQRAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNTLSDSDKEGVRSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLYDSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTPVNINESMLMPPRGMSKTDFEDRLWYATKDTGEYDPYTIKYMNVGSGKYMIIKNGNPKVDKEGKTIIINVEDVNRDERMESTIRHYEHQIFNEHAP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target707 hypothetical protein CLIBASIA_05555 [Candidatus Liberib
315122890583 hypothetical protein CKC_05730 [Candidatus Liberibacter 1 1e-34
315121928547 hypothetical protein CKC_00890 [Candidatus Liberibacter 1 4e-32
317120711753 hypothetical protein SC2_gp045 [Liberibacter phage SC2] 1 1e-16
85059171843 hypothetical protein SG1193 [Sodalis glossinidius str. 1 5e-06
218700979837 hypothetical protein ECIAI39_2669 [Escherichia coli IAI 2 7e-54
323948674837 hypothetical protein ERKG_04897 [Escherichia coli H252] 2 9e-54
117624701837 hypothetical protein APECO1_4052 [Escherichia coli APEC 2 9e-54
324008549837 hypothetical protein HMPREF9532_01736 [Escherichia coli 2 1e-53
331648165837 hypothetical protein ECIG_04091 [Escherichia coli M605] 2 7e-53
215487810836 hypothetical protein E2348C_2743 [Escherichia coli O127 2 1e-52
>gi|315122890|ref|YP_004063379.1| hypothetical protein CKC_05730 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 583 Back     alignment and organism information
 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 146/560 (26%), Positives = 255/560 (45%), Gaps = 37/560 (6%)

Query: 147 EDNLNMTVGLAAAHVLHDPSNENY-FQRVQS--ITDHINSLPIDLRLKQKLLSEAKEKLN 203
           E ++  T    A ++   P+NEN   QR +   + D     P D   K++ L +    L+
Sbjct: 6   EKHIGDTAVALALNIRLSPTNENLELQRNRGYDVIDKSLLTPEDKVKKKQALDKT---LH 62

Query: 204 TNQIIGAHARDPRVFENFMRAFYKKGHPPKDSTSLSDVSDSARERSLEVVEDVSKAIGLA 263
            +Q IG  + +P +  N     Y      KD  S   ++++A   ++E+  D  K  G  
Sbjct: 63  KSQTIGLLSNEPDIVGNLSSLVYGSPVAVKDGLSPDQIAENADGGTIEI--DEHKLDGKT 120

Query: 264 GWDRLDDTKRRRLLEHLSSRDNALNTKLRKETQAQARRI-------DAQLNHG-ITVKPS 315
           G+  +D   R    E L S  +  N K   E Q+  +R+         + N G I+    
Sbjct: 121 GYTGIDSLSR----EDLKSLLDEHNRKTNAERQSGKKRVIETIKLRTTEANKGNISSDYD 176

Query: 316 ELIPLEDYTQAYGVEQGTELYNLQQFKSVAAPDVARIKLMSTFDAKKFLQKIDDEYISNP 375
           E+    + ++ Y       +    + K   AP +  ++ M+  +  +F+  ++   +   
Sbjct: 177 EVFSESNLSRYYQPADVESIITQAKLKKDIAPYIRVVETMTNEEYAEFVSTVNSRTVD-- 234

Query: 376 SLSLASTMMATKYKEILEKSHRQSMQELNQDAISWGIKYKQIDPLRFDTEES-FADSLRQ 434
              L     A  + + L+     S++EL++D   W  + + + P     E    A S+  
Sbjct: 235 -YDLNDRFKAQAFLKELQDKRVASLKELSKDPHGWQ-RSRGLVPPNLSLEAGQLASSVLP 292

Query: 435 RAGFVKKIKDDYNLTTSHFNKTEENQLRTQLVKRPASESVDLIRGAYNT--LSDSDKEGV 492
                +K + D+ +        +E QL  ++    A + V   R       ++ SD E +
Sbjct: 293 IFDANEKTEKDHGVIVKGMGTDKERQLSEKIKGERAEDFVSYFRDEMTKEGVTKSDIEKI 352

Query: 493 RSSFAHIEDNGLSAVVRLSSEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNKFDSLY 552
           +S    ++D   S++ RL+   S +A+ +A+ ++SG+KH+ D E +  +  K N    L+
Sbjct: 353 KSVVDGMKDKVTSSICRLAMSDSAEARASAIPVISGVKHRGDIELKLESS-KGNGVKKLF 411

Query: 553 DSYINTPLTKLEQSTAGGNFNKDKEAIKLYLLGSMKDSGNYTLNRVRVSDAMQIVLGNTP 612
           ++ IN  + +L Q +   N+ +D E IKLY++G+M  +GNYTLN   V DA++ V GNT 
Sbjct: 412 NNLINKEIGQLYQGSEDANYKQDAEVIKLYIMGNMHKTGNYTLNGEVVRDAVKAVFGNTA 471

Query: 613 VNINESMLMPPRGMSKTDFEDRLWYATKD--TGEYD-------PYTIKYMNVGSGKYMII 663
             +N S +MPPRGMS  +F +RL   T D   G +        P +  Y + G GKY + 
Sbjct: 472 YAVNGSYVMPPRGMSHYEFGNRLHGLTSDKLVGLFGDKSKDRYPESYGYQSEGDGKYSLT 531

Query: 664 KNGNPKVDKEGKTIIINVED 683
             G  K DK+G  I+IN+ D
Sbjct: 532 VGGVYKKDKQGNPIVINIYD 551


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315121928|ref|YP_004062417.1| hypothetical protein CKC_00890 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 547 Back     alignment and organism information
>gi|317120711|gb|ADV02533.1| hypothetical protein SC2_gp045 [Liberibacter phage SC2] Length = 753 Back     alignment and organism information
>gi|85059171|ref|YP_454873.1| hypothetical protein SG1193 [Sodalis glossinidius str. 'morsitans'] Length = 843 Back     alignment and organism information
>gi|218700979|ref|YP_002408608.1| hypothetical protein ECIAI39_2669 [Escherichia coli IAI39] Length = 837 Back     alignment and organism information
>gi|323948674|gb|EGB44579.1| hypothetical protein ERKG_04897 [Escherichia coli H252] Length = 837 Back     alignment and organism information
>gi|117624701|ref|YP_853614.1| hypothetical protein APECO1_4052 [Escherichia coli APEC O1] Length = 837 Back     alignment and organism information
>gi|324008549|gb|EGB77768.1| hypothetical protein HMPREF9532_01736 [Escherichia coli MS 57-2] Length = 837 Back     alignment and organism information
>gi|331648165|ref|ZP_08349255.1| hypothetical protein ECIG_04091 [Escherichia coli M605] Length = 837 Back     alignment and organism information
>gi|215487810|ref|YP_002330241.1| hypothetical protein E2348C_2743 [Escherichia coli O127:H6 str. E2348/69] Length = 836 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 707 hypothetical protein CLIBASIA_05555 [Candidatus Liberib
PHA02512844 minor structural protein; Provisional 100.0
>PHA02512 minor structural protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target707 hypothetical protein CLIBASIA_05555 [Candidatus Liberib
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.001
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 40.4 bits (93), Expect = 0.001
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 9/28 (32%)

Query: 361 KKFLQ---KI--DDEYISNPSLSLASTM 383
           KK LQ   K+  DD   S P+L++ +TM
Sbjct: 23  KK-LQASLKLYADD---SAPALAIKATM 46


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00